TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|Q27874|PAT3_CAEEL Integrin beta pat-3 precursor. [Caenorhabditis elegans] (809 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 24 5.7 >super_15687 Length = 322648 Score = 23.9 bits (50), Expect = 5.7 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 574 DRKICAEHGE 583 DRK CAEHGE Sbjct: 175690 DRKECAEHGE 175661 Score = 23.9 bits (50), Expect = 5.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 39 PCYSLSRDNYTCSACIQY 56 PC +L + NY CS ++Y Sbjct: 257294 PCTTLLKINYLCSVVLRY 257347 Score = 23.1 bits (48), Expect = 9.7 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = -2 Query: 671 LNETACDQCEFKVIPVEELPNLNETTPCQFVDPADDCTFYYLYYYDEATDNATVWV 726 L A +Q F P+E LP + C+ P F ++ D T+W+ Sbjct: 111783 LRPPAAEQFTFTTTPMEGLPRQTDR*VCRHRMPT*HTPFAENHWKDFEEFCFTIWI 111616 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.319 0.136 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 346,072 Number of Sequences: 1 Number of extensions: 6539 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 23 length of query: 809 length of database: 107,549 effective HSP length: 77 effective length of query: 732 effective length of database: 107,472 effective search space: 78669504 effective search space used: 78669504 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|P34446|PAT2_CAEEL Integrin alpha pat-2 precursor. [Caenorhabditis elegans] (1226 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 53 3e-16 >super_15687 Length = 322648 Score = 52.8 bits (125), Expect(2) = 8e-16 Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 375 RFGHAVAAAGDLNLDGYNDVIVGAPY--AGKNKQGAVYVIHGSKDGVRELPTQ 425 RFG +VA+AGDL+ +GY+DVI+GAPY + GA+YV + S G+ E Q Sbjct: 124018 RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQ 123860 Score = 52.8 bits (125), Expect(2) = 3e-16 Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 375 RFGHAVAAAGDLNLDGYNDVIVGAPY--AGKNKQGAVYVIHGSKDGVRELPTQ 425 RFG +VA+AGDL+ +GY+DVI+GAPY + GA+YV + S G+ E Q Sbjct: 111868 RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQ 111710 Score = 45.8 bits (107), Expect(2) = 3e-16 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 4/105 (3%) Frame = -3 Query: 424 TQKIEGANIGHGNIKSFGFSLT----GNEDVDGNGMPDIAVGAWKSGNAAVLLTKPVVTV 479 +Q+I G + ++ FG+SL G DVD N PD+ VG+ +S + VL ++P++ V Sbjct: 111668 SQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDV 111492 Query: 480 TGQTEPESALISVEDKNCDVDGKLGKQACKHINTCFKYEGKGDTP 524 + E + LI V + G AC + C + + P Sbjct: 111491 QARVELQPRLIDV------ITCVTGSAACSSVRICLNATFRKEHP 111375 Score = 44.3 bits (103), Expect(2) = 8e-16 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 4/105 (3%) Frame = -3 Query: 424 TQKIEGANIGHGNIKSFGFSLT----GNEDVDGNGMPDIAVGAWKSGNAAVLLTKPVVTV 479 +Q+I G + ++ FG+SL G DVD N PD+ VG+ +S + VL ++P++ V Sbjct: 123818 SQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDV 123642 Query: 480 TGQTEPESALISVEDKNCDVDGKLGKQACKHINTCFKYEGKGDTP 524 + E + I V + G AC + C + + P Sbjct: 123641 QARVELQPRFIDV------ITCVTGSAACSSVRICLNATFRKEHP 123525 Score = 42.0 bits (97), Expect = 3e-05 Identities = 23/64 (35%), Positives = 30/64 (45%), Gaps = 2/64 (3%) Frame = -3 Query: 298 QHGQYCGGSVAVADVNKDGRDDIIMGCPFYTDYGSVKDAKTQERKPQYDVGKVIVML--Q 355 Q G Y G +V D+NKD DD+++ P Y D YD GKV + + Q Sbjct: 124676 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNG------------YDQGKVFLFMNNQ 124533 Query: 356 TAPG 359 T PG Sbjct: 124532 THPG 124521 Score = 42.0 bits (97), Expect = 3e-05 Identities = 23/64 (35%), Positives = 30/64 (45%), Gaps = 2/64 (3%) Frame = -2 Query: 298 QHGQYCGGSVAVADVNKDGRDDIIMGCPFYTDYGSVKDAKTQERKPQYDVGKVIVML--Q 355 Q G Y G +V D+NKD DD+++ P Y D YD GKV + + Q Sbjct: 112530 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNG------------YDQGKVFLFMNNQ 112387 Query: 356 TAPG 359 T PG Sbjct: 112386 THPG 112375 Score = 30.0 bits (66), Expect = 0.12 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 372 QWGRFGHAVAAAGDLNLDGYNDVIVGAP 399 Q FGH V A D+N D Y+D++V AP Sbjct: 112527 QGAYFGHTVVAM-DINKDSYDDLLVSAP 112447 Score = 30.0 bits (66), Expect = 0.12 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -3 Query: 372 QWGRFGHAVAAAGDLNLDGYNDVIVGAP 399 Q FGH V A D+N D Y+D++V AP Sbjct: 124673 QGAYFGHTVVAM-DINKDSYDDLLVSAP 124593 Score = 28.5 bits (62), Expect = 0.36 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 719 PACSPTSDEPDSDGKWTFAC 738 P +P SDEPD+ W FAC Sbjct: 111861 PNLAPLSDEPDNTCGWWFAC 111920 Score = 28.5 bits (62), Expect = 0.36 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 719 PACSPTSDEPDSDGKWTFAC 738 P +P SDEPD+ W FAC Sbjct: 124011 PNLAPLSDEPDNTCGWWFAC 124070 Score = 26.9 bits (58), Expect = 1.1 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 296 STQHGQYCGGSVAVA-DVNKDGRDDIIMGCPF 326 S+ G G SVA A D++++G DD+I+G P+ Sbjct: 111886 SSLSGARFGMSVASAGDLDQNGYDDVIIGAPY 111791 Score = 26.9 bits (58), Expect = 1.1 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 296 STQHGQYCGGSVAVA-DVNKDGRDDIIMGCPF 326 S+ G G SVA A D++++G DD+I+G P+ Sbjct: 124036 SSLSGARFGMSVASAGDLDQNGYDDVIIGAPY 123941 Score = 25.8 bits (55), Expect = 2.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 440 FGFSLTGNEDVDGNGMPDIAVGA 462 FG S+ D+D NG D+ +GA Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGA 111797 Score = 25.8 bits (55), Expect = 2.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 440 FGFSLTGNEDVDGNGMPDIAVGA 462 FG S+ D+D NG D+ +GA Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGA 123947 Score = 25.4 bits (54), Expect = 3.1 Identities = 11/32 (34%), Positives = 17/32 (52%) Frame = -3 Query: 840 QISNRGPSEVDSATLDIFWPSFSTEGGHLLYI 871 Q++N G S +++ WP + G LLYI Sbjct: 109070 QLANAGTLSATSLPMNLVWPEATKGGLPLLYI 108975 Score = 25.0 bits (53), Expect = 4.0 Identities = 10/24 (41%), Positives = 13/24 (53%) Frame = -3 Query: 1057 DYKGPLSRASVDCNSLRCTHIECD 1080 DYKGP +DC+ C +CD Sbjct: 318332 DYKGPYWGKCIDCDQ-ECIDCDCD 318264 Score = 25.0 bits (53), Expect = 4.0 Identities = 12/28 (42%), Positives = 14/28 (49%) Frame = +1 Query: 778 NDEEAHTVADNKVTFTIPVDFKNQLSLN 805 N HT N VT + FK+ LSLN Sbjct: 168649 NKHVTHTTPQNFVTLLLTAYFKSTLSLN 168732 Score = 24.3 bits (51), Expect = 6.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 378 HAVAAAGDLNLDGYNDVIVGAP 399 + VA A D++ + Y DVIVG+P Sbjct: 111605 NGVAGAVDVDNNHYPDVIVGSP 111540 Score = 24.3 bits (51), Expect = 6.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 378 HAVAAAGDLNLDGYNDVIVGAP 399 + VA A D++ + Y DVIVG+P Sbjct: 123755 NGVAGAVDVDNNHYPDVIVGSP 123690 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.315 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 379,397 Number of Sequences: 1 Number of extensions: 5138 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 37 length of query: 1226 length of database: 107,549 effective HSP length: 80 effective length of query: 1146 effective length of database: 107,469 effective search space: 123159474 effective search space used: 123159474 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|Q03600|INA1_CAEEL Integrin alpha ina-1 precursor. [Caenorhabditis elegans] (1139 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 60 1e-10 >super_15687 Length = 322648 Score = 59.7 bits (143), Expect = 1e-10 Identities = 26/70 (37%), Positives = 46/70 (65%), Gaps = 4/70 (5%) Frame = -3 Query: 462 FGFSL----SGGSDMDENGYPDLLIGSPSKNFVALLRSRPVISIETKHKMEKRMVDIDKG 517 FG+SL +G D+D N YPD+++GSP + V +LRSRP+I ++ + +++ R++D+ Sbjct: 111623 FGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRLIDV--- 111453 Query: 518 VNCPRGAKTC 527 + C G+ C Sbjct: 111452 ITCVTGSAAC 111423 Score = 58.9 bits (141), Expect = 2e-10 Identities = 26/70 (37%), Positives = 45/70 (64%), Gaps = 4/70 (5%) Frame = -3 Query: 462 FGFSL----SGGSDMDENGYPDLLIGSPSKNFVALLRSRPVISIETKHKMEKRMVDIDKG 517 FG+SL +G D+D N YPD+++GSP + V +LRSRP+I ++ + +++ R +D+ Sbjct: 123773 FGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRFIDV--- 123603 Query: 518 VNCPRGAKTC 527 + C G+ C Sbjct: 123602 ITCVTGSAAC 123573 Score = 42.0 bits (97), Expect = 3e-05 Identities = 21/64 (32%), Positives = 40/64 (61%), Gaps = 2/64 (3%) Frame = -1 Query: 302 KLTLNEDKFIINGTAM-GSAFGYSIEVV-DLNGDGFDDLIVGAPFEHRSGIDGNFGGIVY 359 +L N +++G+++ G+ FG S+ DL+ +G+DD+I+GAP+E + G +Y Sbjct: 124075 QLQANHQPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS---SGAIY 123905 Query: 360 VYFS 363 VY++ Sbjct: 123904 VYYN 123893 Score = 42.0 bits (97), Expect = 3e-05 Identities = 21/64 (32%), Positives = 40/64 (61%), Gaps = 2/64 (3%) Frame = -1 Query: 302 KLTLNEDKFIINGTAM-GSAFGYSIEVV-DLNGDGFDDLIVGAPFEHRSGIDGNFGGIVY 359 +L N +++G+++ G+ FG S+ DL+ +G+DD+I+GAP+E + G +Y Sbjct: 111925 QLQANHQPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS---SGAIY 111755 Query: 360 VYFS 363 VY++ Sbjct: 111754 VYYN 111743 Score = 38.5 bits (88), Expect = 3e-04 Identities = 28/84 (33%), Positives = 43/84 (50%), Gaps = 5/84 (5%) Frame = -1 Query: 407 SKLNDFAVG---APFAFDGAGAVYIYLGTK-NIEKFRKK-PAQVIKGNDLPNLPPGGMRS 461 ++LND G P+ A Y TK N+ + + QV+ G+ L G R Sbjct: 124177 NRLNDLFSGIVQVPYTICCAAGPNTYKNTK*NLLQLQANHQPQVLSGSSL-----SGAR- 124016 Query: 462 FGFSLSGGSDMDENGYPDLLIGSP 485 FG S++ D+D+NGY D++IG+P Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGAP 123944 Score = 37.7 bits (86), Expect = 6e-04 Identities = 28/84 (33%), Positives = 43/84 (50%), Gaps = 5/84 (5%) Frame = -1 Query: 407 SKLNDFAVG---APFAFDGAGAVYIYLGTK-NIEKFRKK-PAQVIKGNDLPNLPPGGMRS 461 ++LND G P+ A Y TK N+ + + QV+ G+ L G R Sbjct: 112027 NRLNDLFSGIVQVPYTICCAAGQNTYKKTK*NLLQLQANHQPQVLSGSSL-----SGAR- 111866 Query: 462 FGFSLSGGSDMDENGYPDLLIGSP 485 FG S++ D+D+NGY D++IG+P Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGAP 111794 Score = 35.8 bits (81), Expect = 0.002 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 2/64 (3%) Frame = -3 Query: 318 GSAFGYSIEVVDLNGDGFDDLIVGAPFEHRSGIDGNFGGIVYVYFSQGVQRKQHESH--L 375 G+ FG+++ +D+N D +DDL+V AP + ++G G V+++ + + H H Sbjct: 124670 GAYFGHTVVAMDINKDSYDDLLVSAPL--YNDVNGYDQGKVFLF----MNNQTHPGHQMW 124509 Query: 376 VFHP 379 V HP Sbjct: 124508 VSHP 124497 Score = 35.8 bits (81), Expect = 0.002 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 2/64 (3%) Frame = -2 Query: 318 GSAFGYSIEVVDLNGDGFDDLIVGAPFEHRSGIDGNFGGIVYVYFSQGVQRKQHESH--L 375 G+ FG+++ +D+N D +DDL+V AP + ++G G V+++ + + H H Sbjct: 112524 GAYFGHTVVAMDINKDSYDDLLVSAPL--YNDVNGYDQGKVFLF----MNNQTHPGHQMW 112363 Query: 376 VFHP 379 V HP Sbjct: 112362 VSHP 112351 Score = 28.1 bits (61), Expect = 0.44 Identities = 14/38 (36%), Positives = 19/38 (49%) Frame = +3 Query: 906 RKCFIKQQYEYVNPAEIKLNTKYSTQETAPHRVEHRMK 943 R C + Q+ Y P E+ + S T PHRV H+ K Sbjct: 132303 RSCTLLQEASYCIPRELIP*KRKSRLSTYPHRVLHKSK 132416 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.318 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 402,974 Number of Sequences: 1 Number of extensions: 5970 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 33 length of query: 1139 length of database: 107,549 effective HSP length: 79 effective length of query: 1060 effective length of database: 107,470 effective search space: 113918200 effective search space used: 113918200 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissnew|P11584|ITBX_DROME Integrin beta-PS precursor (Position-specific antigen, beta chain) (Myospheroid protein) (Olfactory C protein). [Drosophila melanogaster] (846 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 24 4.6 >super_15687 Length = 322648 Score = 24.3 bits (51), Expect = 4.6 Identities = 19/68 (27%), Positives = 26/68 (37%) Frame = -1 Query: 550 DLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCECDNFSCERN 609 D T +FA C A T+ + + V C C RP+P C F C +N Sbjct: 287494 DHT*EFATKFVCWATFTTQSQYIHYSNRVFAWCLCMNRPHPF---------CPKFGC-KN 287345 Query: 610 RNQLCSGP 617 N+ P Sbjct: 287344 DNRT*KSP 287321 Score = 23.9 bits (50), Expect = 6.0 Identities = 17/46 (36%), Positives = 20/46 (42%), Gaps = 2/46 (4%) Frame = -3 Query: 540 FGNKCECSATDL-TSKFANDTSCRADSTST-TDCSGRGHCVCGACE 583 F EC L TS + N T+ + ST CS G C CG E Sbjct: 165314 FNGNIECPMLCLCTSTWRNKTNYVSPLASTFL*CSLTGRCCCGVVE 165177 Score = 23.5 bits (49), Expect = 7.8 Identities = 10/19 (52%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Frame = -2 Query: 576 HCVCGACEC-HKRPNPIEI 593 HCVC C C H+ PI I Sbjct: 240816 HCVCSYCFCKHELMGPIVI 240760 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.318 0.133 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 344,637 Number of Sequences: 1 Number of extensions: 6575 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 14 length of query: 846 length of database: 107,549 effective HSP length: 77 effective length of query: 769 effective length of database: 107,472 effective search space: 82645968 effective search space used: 82645968 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|Q27591|ITBN_DROME Integrin beta-nu precursor. [Drosophila melanogaster] (799 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 29 0.13 >super_15687 Length = 322648 Score = 29.3 bits (64), Expect = 0.13 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 547 YTGPFCECRECLDCDEKLADCFCGQ 571 Y GP+ +C+DCD++ DC C Q Sbjct: 318329 YKGPYWG--KCIDCDQECIDCDCDQ 318261 Score = 25.4 bits (54), Expect = 1.9 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 198 AAERATCEPTYGYRH--QLSLTDDIPAFTSAVANSKITGNLDNLEGGLDAL 246 +A+R RH ++ + D+P TS VA I+ NL L+GG + + Sbjct: 148257 SAQRRQVRTNVARRHVCRVRVLLDLPQVTSCVACRHISTNLLILQGGAETI 148409 Score = 25.4 bits (54), Expect = 1.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 545 PGYTGPFCECRECLDCDEKLADCFCGQCVCKYG 577 P +G F +CR C ++ FC C K G Sbjct: 71577 PYSSGQFVKCRVCKSLVHQIGAKFCQGCAYKKG 71479 Score = 23.5 bits (49), Expect = 7.4 Identities = 6/19 (31%), Positives = 13/19 (67%) Frame = -2 Query: 584 NCDGDTDACVGPTGEICSE 602 N +G ++ C+G G +C++ Sbjct: 191463 NTNGGSEICLGTAGNVCTQ 191407 Score = 23.5 bits (49), Expect = 7.4 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 6/33 (18%) Frame = -1 Query: 226 AVANSKITGNLDNLEGGLDA------LMQVIVC 252 A+ K TGN+DNL + + ++Q+++C Sbjct: 270193 AIFRHKATGNMDNLTRSIRS*YIQMEILQLVIC 270095 Score = 23.1 bits (48), Expect = 9.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 640 VTCLIEQKQGMGVCENLTE 658 +T L+EQ+ GMG+ E E Sbjct: 28489 ITLLVEQQSGMGLSETERE 28545 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 352,146 Number of Sequences: 1 Number of extensions: 6715 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 22 length of query: 799 length of database: 107,549 effective HSP length: 77 effective length of query: 722 effective length of database: 107,472 effective search space: 77594784 effective search space used: 77594784 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|Q9W1M8|ITA5_DROME Integrin alpha-PS5 precursor (Position-specific antigen 5, alpha chain). [Drosophila melanogaster] (1000 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 50 2e-13 >super_15687 Length = 322648 Score = 50.1 bits (118), Expect(2) = 2e-13 Identities = 23/62 (37%), Positives = 39/62 (62%), Gaps = 5/62 (8%) Frame = -1 Query: 333 SGARFGSSLSKVGDINHDGYNDLAVGAPF-----AGNGAVFIFLGSEHGLRDEPSQRLDA 387 SGARFG S++ GD++ +GY+D+ +GAP+ +GA++++ S GL + Q + Sbjct: 111877 SGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQVSLS 111698 Query: 388 PS 389 PS Sbjct: 111697 PS 111692 Score = 50.1 bits (118), Expect(2) = 2e-13 Identities = 23/62 (37%), Positives = 39/62 (62%), Gaps = 5/62 (8%) Frame = -1 Query: 333 SGARFGSSLSKVGDINHDGYNDLAVGAPF-----AGNGAVFIFLGSEHGLRDEPSQRLDA 387 SGARFG S++ GD++ +GY+D+ +GAP+ +GA++++ S GL + Q + Sbjct: 124027 SGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQVSLS 123848 Query: 388 PS 389 PS Sbjct: 123847 PS 123842 Score = 48.1 bits (113), Expect = 4e-07 Identities = 22/46 (47%), Positives = 32/46 (68%) Frame = -2 Query: 271 QLGEYFGYSVVAEDLNGDGLTDVVVSAPLNALGDSYDVGAIYVFIN 316 Q G YFG++VVA D+N D D++VSAPL + YD G +++F+N Sbjct: 112530 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMN 112393 Score = 48.1 bits (113), Expect = 4e-07 Identities = 22/46 (47%), Positives = 32/46 (68%) Frame = -3 Query: 271 QLGEYFGYSVVAEDLNGDGLTDVVVSAPLNALGDSYDVGAIYVFIN 316 Q G YFG++VVA D+N D D++VSAPL + YD G +++F+N Sbjct: 124676 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMN 124539 Score = 38.9 bits (89), Expect(2) = 2e-13 Identities = 14/48 (29%), Positives = 31/48 (64%) Frame = -3 Query: 403 GLSRGSDIDGNGFNDLAIGAPGAEAVYLYRAYPVVKIHATVRSESRAI 450 G++ D+D N + D+ +G+P +++V++ R+ P++ + A V + R I Sbjct: 111602 GVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRLI 111459 Score = 38.5 bits (88), Expect(2) = 2e-13 Identities = 14/48 (29%), Positives = 31/48 (64%) Frame = -3 Query: 403 GLSRGSDIDGNGFNDLAIGAPGAEAVYLYRAYPVVKIHATVRSESRAI 450 G++ D+D N + D+ +G+P +++V++ R+ P++ + A V + R I Sbjct: 123752 GVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRFI 123609 Score = 35.0 bits (79), Expect = 0.003 Identities = 26/101 (25%), Positives = 45/101 (43%), Gaps = 7/101 (6%) Frame = -1 Query: 400 FGQGLSRGSDIDGNGFNDLAIGAPGAE-------AVYLYRAYPVVKIHATVRSESRAIRP 452 FG ++ D+D NG++D+ IGAP E A+Y+Y H + +R + Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVY-----YNSHGGLTETNRQVSL 123851 Query: 453 EQETITVTACYRLETTSKARQMQQQELTFRMTIDELLQRVS 493 VT +R E+ + ++ L R ++ L Q +S Sbjct: 123850 SPSNAHVTRPFRRESLERL*RVLFYNLDIRW*MELLEQWMS 123728 Score = 34.7 bits (78), Expect = 0.004 Identities = 26/101 (25%), Positives = 45/101 (43%), Gaps = 7/101 (6%) Frame = -1 Query: 400 FGQGLSRGSDIDGNGFNDLAIGAPGAE-------AVYLYRAYPVVKIHATVRSESRAIRP 452 FG ++ D+D NG++D+ IGAP E A+Y+Y H + +R + Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVY-----YNSHGGLTETNRQVSL 111701 Query: 453 EQETITVTACYRLETTSKARQMQQQELTFRMTIDELLQRVS 493 VT +R E+ + ++ L R ++ L Q +S Sbjct: 111700 SPSNAHVTHPFRRESLERL*RVLFYNLDIRW*MELLEQWMS 111578 Score = 31.6 bits (70), Expect = 0.034 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -2 Query: 334 GARFGSSLSKVGDINHDGYNDLAVGAPFAGN------GAVFIFLGSE 374 GA FG ++ + DIN D Y+DL V AP + G VF+F+ ++ Sbjct: 112524 GAYFGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQ 112387 Score = 31.6 bits (70), Expect = 0.034 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -3 Query: 334 GARFGSSLSKVGDINHDGYNDLAVGAPFAGN------GAVFIFLGSE 374 GA FG ++ + DIN D Y+DL V AP + G VF+F+ ++ Sbjct: 124670 GAYFGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQ 124533 Score = 25.0 bits (53), Expect = 3.2 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 154 HFMLELGLSAHVTDDNSGFLIGAPGVR 180 HF + L + TDD G G PG + Sbjct: 56552 HFAFVIILKMYTTDDEKGLNYGKPGAK 56472 Score = 24.3 bits (51), Expect = 5.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 915 LKPNVIFNYSETPLPIW 931 +K N++ N + TPL +W Sbjct: 77694 MKQNILLNKNSTPLSVW 77744 Score = 23.9 bits (50), Expect = 7.2 Identities = 9/22 (40%), Positives = 14/22 (62%) Frame = -2 Query: 622 NVTSSARLPFAKVPGNCRVRHE 643 N+ ++R P +PG CR+R E Sbjct: 298419 NI*INSRKPLTLMPGTCRLRPE 298354 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 331,808 Number of Sequences: 1 Number of extensions: 4879 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 33 length of query: 1000 length of database: 107,549 effective HSP length: 78 effective length of query: 922 effective length of database: 107,471 effective search space: 99088262 effective search space used: 99088262 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|O44386|ITA3_DROME Integrin alpha-PS3 precursor (Position-specific antigen 3, alpha chain) (Scab protein) (Volado protein). [Drosophila melanogaster] (1115 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 49 8e-14 >super_15687 Length = 322648 Score = 49.3 bits (116), Expect(2) = 8e-14 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 5/74 (6%) Frame = -1 Query: 395 NFERQILRSPVETMARFGTALSRLGDINHDGYNDVAVGAPF-----AGNGTVFIYLGSEN 449 N + Q+L + ARFG +++ GD++ +GY+DV +GAP+ +G +++Y S Sbjct: 111913 NHQPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHG 111734 Query: 450 GLRDQPSQRLDAPS 463 GL + Q +PS Sbjct: 111733 GLTETNRQVSLSPS 111692 Score = 49.3 bits (116), Expect(2) = 2e-13 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 5/74 (6%) Frame = -1 Query: 395 NFERQILRSPVETMARFGTALSRLGDINHDGYNDVAVGAPF-----AGNGTVFIYLGSEN 449 N + Q+L + ARFG +++ GD++ +GY+DV +GAP+ +G +++Y S Sbjct: 124063 NHQPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHG 123884 Query: 450 GLRDQPSQRLDAPS 463 GL + Q +PS Sbjct: 123883 GLTETNRQVSLSPS 123842 Score = 45.4 bits (106), Expect = 3e-06 Identities = 22/57 (38%), Positives = 38/57 (66%) Frame = -2 Query: 334 SIHKYHVFRGEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFIN 390 SIH + ++ Q G YFG++V+A D+N D D++VSAP + + +D G +++F+N Sbjct: 112557 SIHPHGMWW--QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMN 112393 Score = 45.4 bits (106), Expect = 3e-06 Identities = 22/57 (38%), Positives = 38/57 (66%) Frame = -3 Query: 334 SIHKYHVFRGEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFIN 390 SIH + ++ Q G YFG++V+A D+N D D++VSAP + + +D G +++F+N Sbjct: 124703 SIHPHGMWW--QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMN 124539 Score = 40.8 bits (94), Expect(2) = 8e-14 Identities = 31/144 (21%), Positives = 66/144 (45%), Gaps = 2/144 (1%) Frame = -3 Query: 476 HGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESREIKPEQEKVKITA 535 +G++ D+D N + D +G+P +++V++ R+ P++ V A V+ + R + + Sbjct: 111605 NGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPR-------LIDVIT 111447 Query: 536 CYRLSTTSTDKLVQEQELAIRIAMDKQLKRVKFTQTQTNEISFKVNANFGEQCRDFETQV 595 C S + ++RI ++ ++ TN + + ++ T++ Sbjct: 111446 CVTGSAACS---------SVRICLNATFRK---EHPPTN-----IGEHISHLAKNMLTRI 111318 Query: 596 RYSEKDIFTPIDLEMH--YELTKK 617 Y F P+D++MH Y LT K Sbjct: 111317 EYL---YFFPLDVKMHTIYPLTCK 111255 Score = 39.3 bits (90), Expect(2) = 2e-13 Identities = 15/49 (30%), Positives = 32/49 (64%) Frame = -3 Query: 476 HGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESREI 524 +G++ D+D N + D +G+P +++V++ R+ P++ V A V+ + R I Sbjct: 123755 NGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRFI 123609 Score = 37.4 bits (85), Expect = 7e-04 Identities = 29/73 (39%), Positives = 36/73 (48%), Gaps = 4/73 (5%) Frame = -1 Query: 336 HKYHVFRGEQF-GEYFGYSVL-AEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINK-- 391 H+ V G G FG SV A DL+ +G DVI+ AP S +GAIYV+ N Sbjct: 124060 HQPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEE-STSTSSGAIYVYYNSHG 123884 Query: 392 GFFNFERQILRSP 404 G RQ+ SP Sbjct: 123883 GLTETNRQVSLSP 123845 Score = 37.4 bits (85), Expect = 7e-04 Identities = 29/73 (39%), Positives = 36/73 (48%), Gaps = 4/73 (5%) Frame = -1 Query: 336 HKYHVFRGEQF-GEYFGYSVL-AEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINK-- 391 H+ V G G FG SV A DL+ +G DVI+ AP S +GAIYV+ N Sbjct: 111910 HQPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEE-STSTSSGAIYVYYNSHG 111734 Query: 392 GFFNFERQILRSP 404 G RQ+ SP Sbjct: 111733 GLTETNRQVSLSP 111695 Score = 33.1 bits (74), Expect = 0.013 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 7/72 (9%) Frame = -1 Query: 474 FGHGLSRGSDIDGNGFNDFAIGAPNAE-------AVYLYRAYPVVKVHATVKSESREIKP 526 FG ++ D+D NG++D IGAP E A+Y+Y H + +R++ Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVY-----YNSHGGLTETNRQVSL 123851 Query: 527 EQEKVKITACYR 538 +T +R Sbjct: 123850 SPSNAHVTRPFR 123815 Score = 32.7 bits (73), Expect = 0.017 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 7/72 (9%) Frame = -1 Query: 474 FGHGLSRGSDIDGNGFNDFAIGAPNAE-------AVYLYRAYPVVKVHATVKSESREIKP 526 FG ++ D+D NG++D IGAP E A+Y+Y H + +R++ Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVY-----YNSHGGLTETNRQVSL 111701 Query: 527 EQEKVKITACYR 538 +T +R Sbjct: 111700 SPSNAHVTHPFR 111665 Score = 28.1 bits (61), Expect = 0.43 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 29 PRPSRVINSPKHLKFHINQT 48 PRPS V SPKH + H+ T Sbjct: 112381 PRPSDVGKSPKHTRLHVTPT 112322 Score = 26.9 bits (58), Expect = 0.95 Identities = 16/72 (22%), Positives = 31/72 (42%), Gaps = 6/72 (8%) Frame = -3 Query: 420 DINHDGYNDVAVGAPFAGN------GTVFIYLGSENGLRDQPSQRLDAPSQQPSKYGSHM 473 DIN D Y+D+ V AP + G VF+++ ++ P ++ Y H+ Sbjct: 124637 DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQT----HPGHQMWVSHPSTLGYTLHL 124470 Query: 474 FGHGLSRGSDID 485 + G +++ Sbjct: 124469 HTNVCPEGKNVE 124434 Score = 26.6 bits (57), Expect = 1.2 Identities = 12/35 (34%), Positives = 20/35 (56%), Gaps = 6/35 (17%) Frame = -2 Query: 420 DINHDGYNDVAVGAPFAGN------GTVFIYLGSE 448 DIN D Y+D+ V AP + G VF+++ ++ Sbjct: 112491 DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQ 112387 Score = 26.6 bits (57), Expect = 1.2 Identities = 10/17 (58%), Positives = 12/17 (69%) Frame = -2 Query: 29 PRPSRVINSPKHLKFHI 45 PRPS V SPKH + H+ Sbjct: 124527 PRPSDVGKSPKHTRLHV 124477 Score = 24.3 bits (51), Expect = 6.2 Identities = 15/41 (36%), Positives = 21/41 (50%) Frame = -1 Query: 566 VKFTQTQTNEISFKVNANFGEQCRDFETQVRYSEKDIFTPI 606 V F T N+ISF +N+NF DF Q + +F P+ Sbjct: 18661 VIFIPTPYNDISFILNSNF-----DFSLQ*MELGRHLFIPM 18554 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.317 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 351,370 Number of Sequences: 1 Number of extensions: 4928 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 37 length of query: 1115 length of database: 107,549 effective HSP length: 79 effective length of query: 1036 effective length of database: 107,470 effective search space: 111338920 effective search space used: 111338920 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|P12080|ITA2_DROME Integrin alpha-PS2 precursor (Position-specific antigen 2, alpha chain) (Protein inflated). [Drosophila melanogaster] (1396 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 45 2e-12 >super_15687 Length = 322648 Score = 45.4 bits (106), Expect(2) = 2e-12 Identities = 21/46 (45%), Positives = 31/46 (66%), Gaps = 4/46 (8%) Frame = -3 Query: 466 FGFAL----SGGLDMDGNTYPDLAVGAYSSDQVFIFKSRPVAAVNA 507 FG++L +G +D+D N YPD+ VG+ SD VF+ +SRP+ V A Sbjct: 111623 FGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQA 111486 Score = 45.4 bits (106), Expect(2) = 2e-12 Identities = 21/46 (45%), Positives = 31/46 (66%), Gaps = 4/46 (8%) Frame = -3 Query: 466 FGFAL----SGGLDMDGNTYPDLAVGAYSSDQVFIFKSRPVAAVNA 507 FG++L +G +D+D N YPD+ VG+ SD VF+ +SRP+ V A Sbjct: 123773 FGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQA 123636 Score = 40.0 bits (92), Expect(2) = 2e-12 Identities = 17/49 (34%), Positives = 30/49 (60%), Gaps = 2/49 (4%) Frame = -1 Query: 396 SKGRFGLALTTLGDVNGDGYGDFAVGAPYD--GPEGRGVVYIFHGSPMG 442 S RFG+++ + GD++ +GY D +GAPY+ G +Y+++ S G Sbjct: 111877 SGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGG 111731 Score = 40.0 bits (92), Expect(2) = 2e-12 Identities = 17/49 (34%), Positives = 30/49 (60%), Gaps = 2/49 (4%) Frame = -1 Query: 396 SKGRFGLALTTLGDVNGDGYGDFAVGAPYD--GPEGRGVVYIFHGSPMG 442 S RFG+++ + GD++ +GY D +GAPY+ G +Y+++ S G Sbjct: 124027 SGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGG 123881 Score = 27.7 bits (60), Expect = 0.71 Identities = 13/68 (19%), Positives = 28/68 (41%) Frame = -1 Query: 466 FGFALSGGLDMDGNTYPDLAVGAYSSDQVFIFKSRPVAAVNAETSFASNSKLISLDDRSC 525 FG +++ D+D N Y D+ +GA + N+ ++ +SL + Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQVSLSPSNA 123836 Query: 526 QLVRDHKK 533 + R ++ Sbjct: 123835 HVTRPFRR 123812 Score = 26.9 bits (58), Expect = 1.2 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -3 Query: 327 QIGEYFGYSLATSXXXXXXXXXXXXXAPMYTDPDNVEGKYDVGRVYILL 375 Q G YFG+++ AP+Y D + YD G+V++ + Sbjct: 124676 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNG----YDQGKVFLFM 124542 Score = 26.9 bits (58), Expect = 1.2 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -2 Query: 327 QIGEYFGYSLATSXXXXXXXXXXXXXAPMYTDPDNVEGKYDVGRVYILL 375 Q G YFG+++ AP+Y D + YD G+V++ + Sbjct: 112530 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNG----YDQGKVFLFM 112396 Score = 26.6 bits (57), Expect = 1.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 280 GYSMVTGDFDGDRSEDVAIGMPR 302 GYS+ +G+F G +E +A G+P+ Sbjct: 124894 GYSVTSGNFYGGATEYIASGVPK 124826 Score = 26.6 bits (57), Expect = 1.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 280 GYSMVTGDFDGDRSEDVAIGMPR 302 GYS+ +G+F G +E +A G+P+ Sbjct: 112748 GYSVTSGNFYGGATEYIASGVPK 112680 Score = 25.8 bits (55), Expect = 2.7 Identities = 12/68 (17%), Positives = 27/68 (39%) Frame = -1 Query: 466 FGFALSGGLDMDGNTYPDLAVGAYSSDQVFIFKSRPVAAVNAETSFASNSKLISLDDRSC 525 FG +++ D+D N Y D+ +GA + N+ ++ +SL + Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQVSLSPSNA 111686 Query: 526 QLVRDHKK 533 + ++ Sbjct: 111685 HVTHPFRR 111662 Score = 25.8 bits (55), Expect = 2.7 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 3/78 (3%) Frame = -2 Query: 409 DVNGDGYGDFAVGAP-YDGPEG--RGVVYIFHGSPMGPLAKPSQIIKSEQLVEGAPYPRT 465 D+N D Y D V AP Y+ G +G V++F + P Q+ +P T Sbjct: 112491 DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTHP---------GHQM--WVSHPST 112345 Query: 466 FGFALSGGLDMDGNTYPD 483 G+ L + N YP+ Sbjct: 112344 LGYT----LHLHTNVYPE 112303 Score = 25.4 bits (54), Expect = 3.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 851 RNNRPSIIEEAEVFIHLPYETIVGDPLMYLLNQ 883 RNN SI+ E PYE ++ ++L+N+ Sbjct: 158377 RNNEASILAEYRYLFASPYEELLRTQPLWLINR 158279 Score = 25.0 bits (53), Expect = 4.6 Identities = 14/38 (36%), Positives = 20/38 (51%), Gaps = 3/38 (7%) Frame = -3 Query: 409 DVNGDGYGDFAVGAP-YDGPEG--RGVVYIFHGSPMGP 443 D+N D Y D V AP Y+ G +G V++F + P Sbjct: 124637 DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTHP 124524 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.317 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 450,008 Number of Sequences: 1 Number of extensions: 6302 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 37 length of query: 1396 length of database: 107,549 effective HSP length: 81 effective length of query: 1315 effective length of database: 107,468 effective search space: 141320420 effective search space used: 141320420 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissprot|Q9V7A4|ITA4_DROME Integrin alpha-PS4 precursor (Position-specific antigen 4, alpha chain). [Drosophila melanogaster] (1015 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 53 2e-13 >super_15687 Length = 322648 Score = 52.8 bits (125), Expect = 1e-08 Identities = 23/62 (37%), Positives = 38/62 (61%) Frame = -3 Query: 270 GEYFGYSVLAEDLNGDGKTDVIISAPLYALRNSYDDGAIYVFINKGSFTFEERIIRSPAG 329 G YFG++V+A D+N D D+++SAPLY N YD G +++F+N + + + P+ Sbjct: 124670 GAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTHPGHQMWVSHPST 124491 Query: 330 SG 331 G Sbjct: 124490 LG 124485 Score = 52.8 bits (125), Expect = 1e-08 Identities = 23/62 (37%), Positives = 38/62 (61%) Frame = -2 Query: 270 GEYFGYSVLAEDLNGDGKTDVIISAPLYALRNSYDDGAIYVFINKGSFTFEERIIRSPAG 329 G YFG++V+A D+N D D+++SAPLY N YD G +++F+N + + + P+ Sbjct: 112524 GAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTHPGHQMWVSHPST 112345 Query: 330 SG 331 G Sbjct: 112344 LG 112339 Score = 50.8 bits (120), Expect(2) = 2e-13 Identities = 22/72 (30%), Positives = 44/72 (60%), Gaps = 5/72 (6%) Frame = -1 Query: 320 EERIIRSPAGSGGRFGTTLSRIGDINKDGYNDVAVGAPF-----AGNGSVFIYLGSENGL 374 + +++ + SG RFG +++ GD++++GY+DV +GAP+ +G++++Y S GL Sbjct: 111907 QPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGL 111728 Query: 375 RDPPSQCLDAPS 386 + Q +PS Sbjct: 111727 TETNRQVSLSPS 111692 Score = 50.8 bits (120), Expect(2) = 4e-13 Identities = 22/72 (30%), Positives = 44/72 (60%), Gaps = 5/72 (6%) Frame = -1 Query: 320 EERIIRSPAGSGGRFGTTLSRIGDINKDGYNDVAVGAPF-----AGNGSVFIYLGSENGL 374 + +++ + SG RFG +++ GD++++GY+DV +GAP+ +G++++Y S GL Sbjct: 124057 QPQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGL 123878 Query: 375 RDPPSQCLDAPS 386 + Q +PS Sbjct: 123877 TETNRQVSLSPS 123842 Score = 37.7 bits (86), Expect(2) = 2e-13 Identities = 15/55 (27%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = -3 Query: 395 YMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKIHAII--KPKLQNV 447 Y +G++ D+D N + D +G+P +++V++ R+ P++ + A + +P+L +V Sbjct: 111617 YSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRLIDV 111453 Score = 37.0 bits (84), Expect(2) = 4e-13 Identities = 12/47 (25%), Positives = 30/47 (63%) Frame = -3 Query: 395 YMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKIHAIIK 441 Y +G++ D+D N + D +G+P +++V++ R+ P++ + A ++ Sbjct: 123767 YSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVE 123627 Score = 34.7 bits (78), Expect = 0.004 Identities = 23/45 (51%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 270 GEYFGYSVL-AEDLNGDGKTDVIISAPLYALRNSYDDGAIYVFIN 313 G FG SV A DL+ +G DVII AP Y S GAIYV+ N Sbjct: 111874 GARFGMSVASAGDLDQNGYDDVIIGAP-YEESTSTSSGAIYVYYN 111743 Score = 34.7 bits (78), Expect = 0.004 Identities = 23/45 (51%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 270 GEYFGYSVL-AEDLNGDGKTDVIISAPLYALRNSYDDGAIYVFIN 313 G FG SV A DL+ +G DVII AP Y S GAIYV+ N Sbjct: 124024 GARFGMSVASAGDLDQNGYDDVIIGAP-YEESTSTSSGAIYVYYN 123893 Score = 31.6 bits (70), Expect = 0.035 Identities = 15/39 (38%), Positives = 22/39 (55%), Gaps = 7/39 (17%) Frame = -1 Query: 397 FGHGLSRGSDIDGNGFNDFAIGAPNAE-------AVYLY 428 FG ++ D+D NG++D IGAP E A+Y+Y Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVY 111749 Score = 31.6 bits (70), Expect = 0.035 Identities = 15/39 (38%), Positives = 22/39 (55%), Gaps = 7/39 (17%) Frame = -1 Query: 397 FGHGLSRGSDIDGNGFNDFAIGAPNAE-------AVYLY 428 FG ++ D+D NG++D IGAP E A+Y+Y Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVY 123899 Score = 31.6 bits (70), Expect = 0.035 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -2 Query: 331 GGRFGTTLSRIGDINKDGYNDVAVGAPFAGN------GSVFIYLGSE 371 G FG T+ + DINKD Y+D+ V AP + G VF+++ ++ Sbjct: 112524 GAYFGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQ 112387 Score = 31.6 bits (70), Expect = 0.035 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = -3 Query: 331 GGRFGTTLSRIGDINKDGYNDVAVGAPFAGN------GSVFIYLGSE 371 G FG T+ + DINKD Y+D+ V AP + G VF+++ ++ Sbjct: 124670 GAYFGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQ 124533 Score = 23.9 bits (50), Expect = 7.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 555 VVDPAEPKFVTEYITFNTGCA 575 ++DP + K VT TF GC+ Sbjct: 110770 ILDPMKAKTVTADFTFEKGCS 110708 Score = 23.9 bits (50), Expect = 7.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 555 VVDPAEPKFVTEYITFNTGCA 575 ++DP + K VT TF GC+ Sbjct: 122951 ILDPMKAKTVTADFTFEKGCS 122889 Score = 23.5 bits (49), Expect = 9.5 Identities = 24/65 (36%), Positives = 33/65 (49%), Gaps = 11/65 (16%) Frame = +3 Query: 567 YITF-----NTGCATDVCVADLKISCIN----ASSTLVLGTTAVLR-LTYNITNNG-EFA 615 +ITF N+G TD C ++ +SCI+ ST+ L TAV + LT I + E Sbjct: 263691 HITFSTKKSNSGKLTDNCSMNVLVSCISYC*LIFSTINLFYTAVRKSLTMLIYRSYLELP 263870 Query: 616 YHPKF 620 H KF Sbjct: 263871 MHDKF 263885 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.316 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 349,388 Number of Sequences: 1 Number of extensions: 5178 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 29 length of query: 1015 length of database: 107,549 effective HSP length: 78 effective length of query: 937 effective length of database: 107,471 effective search space: 100700327 effective search space used: 100700327 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= swissnew|Q24247|ITA1_DROME Integrin alpha-PS1 precursor (Position-specific antigen 1, alpha chain) (Protein multiple edematous wings). [Drosophila melanogaster] (1146 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 47 3e-14 >super_15687 Length = 322648 Score = 46.6 bits (109), Expect(2) = 3e-14 Identities = 25/73 (34%), Positives = 40/73 (54%) Frame = -3 Query: 450 ISGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPA 509 ++G D+D+N YPDV++G+ S + +L +RPII +Q V+ + P +D Sbjct: 111599 VAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQ---------PRLID--- 111456 Query: 510 SNLTCFTFRACCS 522 +TC T A CS Sbjct: 111455 -VITCVTGSAACS 111420 Score = 46.2 bits (108), Expect(2) = 4e-14 Identities = 25/73 (34%), Positives = 40/73 (54%) Frame = -3 Query: 450 ISGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPNTPGCLDDPA 509 ++G D+D+N YPDV++G+ S + +L +RPII +Q V+ + P +D Sbjct: 123749 VAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQ---------PRFID--- 123606 Query: 510 SNLTCFTFRACCS 522 +TC T A CS Sbjct: 123605 -VITCVTGSAACS 123570 Score = 45.1 bits (105), Expect(2) = 4e-14 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 5/54 (9%) Frame = -1 Query: 378 SRFGLALANIGDLNKDNCEDLAVGAPYE-----GNGVVYIYLGSSQGLNSKPAQ 426 +RFG+++A+ GDL+++ +D+ +GAPYE +G +Y+Y S GL Q Sbjct: 124021 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQ 123860 Score = 45.1 bits (105), Expect(2) = 3e-14 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 5/54 (9%) Frame = -1 Query: 378 SRFGLALANIGDLNKDNCEDLAVGAPYE-----GNGVVYIYLGSSQGLNSKPAQ 426 +RFG+++A+ GDL+++ +D+ +GAPYE +G +Y+Y S GL Q Sbjct: 111871 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLTETNRQ 111710 Score = 35.8 bits (81), Expect = 0.002 Identities = 19/48 (39%), Positives = 28/48 (57%), Gaps = 2/48 (4%) Frame = -2 Query: 316 QFGSSFGYELATADINGDHRPDLIVAAPLY--FTKTEGGAVYVYQNIQ 361 Q G+ FG+ + DIN D DL+V+APLY + G V+++ N Q Sbjct: 112530 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQ 112387 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 19/48 (39%), Positives = 28/48 (57%), Gaps = 2/48 (4%) Frame = -3 Query: 316 QFGSSFGYELATADINGDHRPDLIVAAPLY--FTKTEGGAVYVYQNIQ 361 Q G+ FG+ + DIN D DL+V+APLY + G V+++ N Q Sbjct: 124676 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQ 124533 Score = 32.7 bits (73), Expect = 0.018 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = -1 Query: 311 ILDGEQF-GSSFGYELATA-DINGDHRPDLIVAAPLY-FTKTEGGAVYVYQN 359 +L G G+ FG +A+A D++ + D+I+ AP T T GA+YVY N Sbjct: 111898 VLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYN 111743 Score = 32.7 bits (73), Expect = 0.018 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = -1 Query: 311 ILDGEQF-GSSFGYELATA-DINGDHRPDLIVAAPLY-FTKTEGGAVYVYQN 359 +L G G+ FG +A+A D++ + D+I+ AP T T GA+YVY N Sbjct: 124048 VLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYN 123893 Score = 32.3 bits (72), Expect = 0.023 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 446 FGISISGNTDLDDNSYPDVVIGA 468 FG+S++ DLD N Y DV+IGA Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGA 111797 Score = 32.3 bits (72), Expect = 0.023 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 446 FGISISGNTDLDDNSYPDVVIGA 468 FG+S++ DLD N Y DV+IGA Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGA 123947 Score = 29.3 bits (64), Expect = 0.20 Identities = 14/39 (35%), Positives = 22/39 (55%), Gaps = 2/39 (5%) Frame = -3 Query: 261 VDKYSYLGMSVTGGRFFGHMS--YAAGAPRSEGHGQVVI 297 + KY G SVT G F+G + A+G P+ + G V++ Sbjct: 112769 ITKYLNPGYSVTSGNFYGGATEYIASGVPKFQSKGTVIV 112653 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 14/39 (35%), Positives = 22/39 (55%), Gaps = 2/39 (5%) Frame = -1 Query: 261 VDKYSYLGMSVTGGRFFGHMS--YAAGAPRSEGHGQVVI 297 + KY G SVT G F+G + A+G P+ + G V++ Sbjct: 124915 ITKYLNPGYSVTSGNFYGGATEYIASGVPKFQSKGTVIV 124799 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.318 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 392,928 Number of Sequences: 1 Number of extensions: 5787 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 36 length of query: 1146 length of database: 107,549 effective HSP length: 79 effective length of query: 1067 effective length of database: 107,470 effective search space: 114670490 effective search space used: 114670490 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|7494497|pir||T18523 integrin alpha chain - Geodia cydonium (1086 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 48 4e-07 >super_15687 Length = 322648 Score = 48.1 bits (113), Expect = 4e-07 Identities = 20/47 (42%), Positives = 35/47 (73%) Frame = -2 Query: 295 QMGEYYGFSLVALNLAGDSLDELIVSAPMYRDRNIGAETGRIYIYRN 341 Q G Y+G ++VA+++ DS D+L+VSAP+Y D N G + G+++++ N Sbjct: 112530 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVN-GYDQGKVFLFMN 112393 Score = 48.1 bits (113), Expect = 4e-07 Identities = 20/47 (42%), Positives = 35/47 (73%) Frame = -3 Query: 295 QMGEYYGFSLVALNLAGDSLDELIVSAPMYRDRNIGAETGRIYIYRN 341 Q G Y+G ++VA+++ DS D+L+VSAP+Y D N G + G+++++ N Sbjct: 124676 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVN-GYDQGKVFLFMN 124539 Score = 44.7 bits (104), Expect = 4e-06 Identities = 24/65 (36%), Positives = 41/65 (62%), Gaps = 5/65 (7%) Frame = -1 Query: 359 SRFGHAMASLGDITGDGFDDVAVSAPF----GAEQGTVYIYHSSASQFLTPTPQQV-ITP 413 +RFG ++AS GD+ +G+DDV + AP+ G +Y+Y++S LT T +QV ++P Sbjct: 124021 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGG-LTETNRQVSLSP 123845 Query: 414 STLNL 418 S ++ Sbjct: 123844 SNAHV 123830 Score = 44.7 bits (104), Expect = 4e-06 Identities = 24/65 (36%), Positives = 41/65 (62%), Gaps = 5/65 (7%) Frame = -1 Query: 359 SRFGHAMASLGDITGDGFDDVAVSAPF----GAEQGTVYIYHSSASQFLTPTPQQV-ITP 413 +RFG ++AS GD+ +G+DDV + AP+ G +Y+Y++S LT T +QV ++P Sbjct: 111871 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGG-LTETNRQVSLSP 111695 Query: 414 STLNL 418 S ++ Sbjct: 111694 SNAHV 111680 Score = 38.5 bits (88), Expect = 3e-04 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 5/82 (6%) Frame = -3 Query: 404 TPTPQQVITPSTLNLMPIIISEFESFGTALAS-----FDVDGNGFNDLAIGSYKDQSAVV 458 TP Q++I + + S FG +L + DVD N + D+ +GS + S V Sbjct: 111677 TPLSQRIIGKT-------LKSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFV 111519 Query: 459 LRTRPLAQVTTTLVATPGIVDI 480 LR+RP+ V + P ++D+ Sbjct: 111518 LRSRPIIDVQARVELQPRLIDV 111453 Score = 37.7 bits (86), Expect = 5e-04 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 5/82 (6%) Frame = -3 Query: 404 TPTPQQVITPSTLNLMPIIISEFESFGTALAS-----FDVDGNGFNDLAIGSYKDQSAVV 458 TP Q++I + + S FG +L + DVD N + D+ +GS + S V Sbjct: 123827 TPLSQRIIGKT-------LKSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFV 123669 Query: 459 LRTRPLAQVTTTLVATPGIVDI 480 LR+RP+ V + P +D+ Sbjct: 123668 LRSRPIIDVQARVELQPRFIDV 123603 Score = 33.5 bits (75), Expect = 0.010 Identities = 22/62 (35%), Positives = 36/62 (57%), Gaps = 6/62 (9%) Frame = -2 Query: 361 FGHAMASLGDITGDGFDDVAVSAPF-----GAEQGTVYIYHSSASQFLTPTPQQVIT-PS 414 FGH + ++ DI D +DD+ VSAP G +QG V+++ ++ + P Q ++ PS Sbjct: 112515 FGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTH---PGHQMWVSHPS 112348 Query: 415 TL 416 TL Sbjct: 112347 TL 112342 Score = 33.5 bits (75), Expect = 0.010 Identities = 22/62 (35%), Positives = 36/62 (57%), Gaps = 6/62 (9%) Frame = -3 Query: 361 FGHAMASLGDITGDGFDDVAVSAPF-----GAEQGTVYIYHSSASQFLTPTPQQVIT-PS 414 FGH + ++ DI D +DD+ VSAP G +QG V+++ ++ + P Q ++ PS Sbjct: 124661 FGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTH---PGHQMWVSHPS 124494 Query: 415 TL 416 TL Sbjct: 124493 TL 124488 Score = 25.4 bits (54), Expect = 2.7 Identities = 12/28 (42%), Positives = 21/28 (74%), Gaps = 1/28 (3%) Frame = -1 Query: 429 FGTALASF-DVDGNGFNDLAIGSYKDQS 455 FG ++AS D+D NG++D+ IG+ ++S Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGAPYEES 111782 Score = 25.4 bits (54), Expect = 2.7 Identities = 12/28 (42%), Positives = 21/28 (74%), Gaps = 1/28 (3%) Frame = -1 Query: 429 FGTALASF-DVDGNGFNDLAIGSYKDQS 455 FG ++AS D+D NG++D+ IG+ ++S Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGAPYEES 123932 Score = 25.0 bits (53), Expect = 3.5 Identities = 9/16 (56%), Positives = 12/16 (74%) Frame = +1 Query: 851 WRTIQSTSVSVSCDTT 866 WR + +TSV+V C TT Sbjct: 167104 WRVMSATSVAVRCGTT 167151 Score = 24.6 bits (52), Expect = 4.6 Identities = 11/34 (32%), Positives = 17/34 (49%) Frame = -3 Query: 936 LPEDRDNIANNHTCAAIVCEVRQLRAGNRVQVEI 969 LP+ + + NH C C + L A N + V+I Sbjct: 17408 LPQGKRCVTGNHLC*RFECR*K*LNAHNHLDVKI 17307 Score = 24.6 bits (52), Expect = 4.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 837 KDSENKNYFLYLTGWRTIQSTSVSVSCDTT 866 K +++N Y++ W+T S ++C TT Sbjct: 19240 KKGKSRNLLQYISKWKTYCSQMSHLNCKTT 19151 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.317 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 321,778 Number of Sequences: 1 Number of extensions: 4343 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 23 length of query: 1086 length of database: 107,549 effective HSP length: 79 effective length of query: 1007 effective length of database: 107,470 effective search space: 108222290 effective search space used: 108222290 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|4140291|emb|CAA77071.1| integrin beta subunit [Geodia cydonium] (878 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 28 0.43 >super_15687 Length = 322648 Score = 27.7 bits (60), Expect = 0.43 Identities = 10/22 (45%), Positives = 13/22 (58%) Frame = -2 Query: 572 ECTCDGCRCLPEPVTGLPYTMS 593 +C CD CL P+TG +T S Sbjct: 245343 DCPCDNVTCLIRPLTGTKHTYS 245278 Score = 25.4 bits (54), Expect = 2.1 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -3 Query: 493 ICQCDSSGATTDGNSNILQCPLGISGLQCSGRGTCTCGICE 533 +C C S T N PL + L CS G C CG+ E Sbjct: 165287 LCLCTS----TWRNKTNYVSPLASTFL*CSLTGRCCCGVVE 165177 Score = 24.3 bits (51), Expect = 4.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 589 PYTMSDCSCTPNTQTCVD 606 P+T S +C+PN +C D Sbjct: 251760 PFTCSCDNCSPNLMSCTD 251707 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.319 0.137 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 350,257 Number of Sequences: 1 Number of extensions: 6343 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 26 length of query: 878 length of database: 107,549 effective HSP length: 77 effective length of query: 801 effective length of database: 107,472 effective search space: 86085072 effective search space used: 86085072 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|2240039|gb|AAB66911.1| integrin subunit betaPo1 [Ophlitaspongia tenuis] (838 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done ***** No hits found ****** Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.320 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 340,417 Number of Sequences: 1 Number of extensions: 5983 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 16 length of query: 838 length of database: 107,549 effective HSP length: 77 effective length of query: 761 effective length of database: 107,472 effective search space: 81786192 effective search space used: 81786192 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|2240037|gb|AAB66910.1| integrin subunit betaCn1 [Acropora millepora] (792 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 25 2.5 >super_15687 Length = 322648 Score = 25.0 bits (53), Expect = 2.5 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 446 DRKEYNSSACNKLGALTCGLCACNEGRFGKFCQCDTPF 483 ++K C K+ ++ GLC C F C D PF Sbjct: 90817 NKKRKAFGKCKKIKSIILGLCFC----FMLICTSDPPF 90918 Score = 23.9 bits (50), Expect = 5.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 506 GECACGECVCRVEQ 519 G C CG+ VCR+ + Sbjct: 313223 GRCLCGDMVCRLSR 313264 Score = 23.5 bits (49), Expect = 7.3 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 294 IAHLHEKLQESNVLPIFAVTKQFASLYKSVSTMWS 328 IA EKL + ++ F FA Y+ V WS Sbjct: 122984 IARKREKLSQQSLKLQFGSQLNFAKEYRKVRFFWS 123088 Score = 23.5 bits (49), Expect = 7.3 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 294 IAHLHEKLQESNVLPIFAVTKQFASLYKSVSTMWS 328 IA EKL + ++ F FA Y+ V WS Sbjct: 110803 IARKREKLSQQSLKLQFGSQLNFAKEYRKVRFFWS 110907 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.318 0.134 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 346,597 Number of Sequences: 1 Number of extensions: 6457 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 13 length of query: 792 length of database: 107,549 effective HSP length: 76 effective length of query: 716 effective length of database: 107,473 effective search space: 76950668 effective search space used: 76950668 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|4468704|emb|CAB38100.1| integrin beta subunit [Suberites domuncula] (764 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 24 5.4 >super_15687 Length = 322648 Score = 23.9 bits (50), Expect = 5.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 605 NGTSLTYDALSNTFRLRLPTGECPETC 631 NGT + + F+LRL T C + C Sbjct: 210056 NGTENNQNCVCKMFKLRLGTD*CEQMC 209976 Score = 23.9 bits (50), Expect = 5.4 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 340 NATFQVSVTL-QECTPENSGNIVTVPIRVLGFGSFDIELNAIC-SCPC 385 N+ F V L Q+CT + + T I+ F ELN + SC C Sbjct: 99745 NSLFTSHVLL*QKCTHQRNTEYFTASIKTYNLLPFKDELNVVVFSCCC 99602 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.320 0.139 0.446 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 321,248 Number of Sequences: 1 Number of extensions: 5870 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 17 Number of HSP's gapped (non-prelim): 24 length of query: 764 length of database: 107,549 effective HSP length: 76 effective length of query: 688 effective length of database: 107,473 effective search space: 73941424 effective search space used: 73941424 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|2546946|emb|CAA65943.1| integrin [Geodia cydonium] (1086 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 48 4e-07 >super_15687 Length = 322648 Score = 48.1 bits (113), Expect = 4e-07 Identities = 20/47 (42%), Positives = 35/47 (73%) Frame = -2 Query: 295 QMGEYYGFSLVALNLAGDSLDELIVSAPMYRDRNIGAETGRIYIYRN 341 Q G Y+G ++VA+++ DS D+L+VSAP+Y D N G + G+++++ N Sbjct: 112530 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVN-GYDQGKVFLFMN 112393 Score = 48.1 bits (113), Expect = 4e-07 Identities = 20/47 (42%), Positives = 35/47 (73%) Frame = -3 Query: 295 QMGEYYGFSLVALNLAGDSLDELIVSAPMYRDRNIGAETGRIYIYRN 341 Q G Y+G ++VA+++ DS D+L+VSAP+Y D N G + G+++++ N Sbjct: 124676 QQGAYFGHTVVAMDINKDSYDDLLVSAPLYNDVN-GYDQGKVFLFMN 124539 Score = 44.7 bits (104), Expect = 4e-06 Identities = 24/65 (36%), Positives = 41/65 (62%), Gaps = 5/65 (7%) Frame = -1 Query: 359 SRFGHAMASLGDITGDGFDDVAVSAPF----GAEQGTVYIYHSSASQFLTPTPQQV-ITP 413 +RFG ++AS GD+ +G+DDV + AP+ G +Y+Y++S LT T +QV ++P Sbjct: 124021 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGG-LTETNRQVSLSP 123845 Query: 414 STLNL 418 S ++ Sbjct: 123844 SNAHV 123830 Score = 44.7 bits (104), Expect = 4e-06 Identities = 24/65 (36%), Positives = 41/65 (62%), Gaps = 5/65 (7%) Frame = -1 Query: 359 SRFGHAMASLGDITGDGFDDVAVSAPF----GAEQGTVYIYHSSASQFLTPTPQQV-ITP 413 +RFG ++AS GD+ +G+DDV + AP+ G +Y+Y++S LT T +QV ++P Sbjct: 111871 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGG-LTETNRQVSLSP 111695 Query: 414 STLNL 418 S ++ Sbjct: 111694 SNAHV 111680 Score = 38.5 bits (88), Expect = 3e-04 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 5/82 (6%) Frame = -3 Query: 404 TPTPQQVITPSTLNLMPIIISEFESFGTALAS-----FDVDGNGFNDLAIGSYKDQSAVV 458 TP Q++I + + S FG +L + DVD N + D+ +GS + S V Sbjct: 111677 TPLSQRIIGKT-------LKSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFV 111519 Query: 459 LRTRPLAQVTTTLVATPGIVDI 480 LR+RP+ V + P ++D+ Sbjct: 111518 LRSRPIIDVQARVELQPRLIDV 111453 Score = 37.7 bits (86), Expect = 5e-04 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 5/82 (6%) Frame = -3 Query: 404 TPTPQQVITPSTLNLMPIIISEFESFGTALAS-----FDVDGNGFNDLAIGSYKDQSAVV 458 TP Q++I + + S FG +L + DVD N + D+ +GS + S V Sbjct: 123827 TPLSQRIIGKT-------LKSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFV 123669 Query: 459 LRTRPLAQVTTTLVATPGIVDI 480 LR+RP+ V + P +D+ Sbjct: 123668 LRSRPIIDVQARVELQPRFIDV 123603 Score = 33.5 bits (75), Expect = 0.010 Identities = 22/62 (35%), Positives = 36/62 (57%), Gaps = 6/62 (9%) Frame = -2 Query: 361 FGHAMASLGDITGDGFDDVAVSAPF-----GAEQGTVYIYHSSASQFLTPTPQQVIT-PS 414 FGH + ++ DI D +DD+ VSAP G +QG V+++ ++ + P Q ++ PS Sbjct: 112515 FGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTH---PGHQMWVSHPS 112348 Query: 415 TL 416 TL Sbjct: 112347 TL 112342 Score = 33.5 bits (75), Expect = 0.010 Identities = 22/62 (35%), Positives = 36/62 (57%), Gaps = 6/62 (9%) Frame = -3 Query: 361 FGHAMASLGDITGDGFDDVAVSAPF-----GAEQGTVYIYHSSASQFLTPTPQQVIT-PS 414 FGH + ++ DI D +DD+ VSAP G +QG V+++ ++ + P Q ++ PS Sbjct: 124661 FGHTVVAM-DINKDSYDDLLVSAPLYNDVNGYDQGKVFLFMNNQTH---PGHQMWVSHPS 124494 Query: 415 TL 416 TL Sbjct: 124493 TL 124488 Score = 25.4 bits (54), Expect = 2.7 Identities = 12/28 (42%), Positives = 21/28 (74%), Gaps = 1/28 (3%) Frame = -1 Query: 429 FGTALASF-DVDGNGFNDLAIGSYKDQS 455 FG ++AS D+D NG++D+ IG+ ++S Sbjct: 111865 FGMSVASAGDLDQNGYDDVIIGAPYEES 111782 Score = 25.4 bits (54), Expect = 2.7 Identities = 12/28 (42%), Positives = 21/28 (74%), Gaps = 1/28 (3%) Frame = -1 Query: 429 FGTALASF-DVDGNGFNDLAIGSYKDQS 455 FG ++AS D+D NG++D+ IG+ ++S Sbjct: 124015 FGMSVASAGDLDQNGYDDVIIGAPYEES 123932 Score = 25.0 bits (53), Expect = 3.5 Identities = 9/16 (56%), Positives = 12/16 (74%) Frame = +1 Query: 851 WRTIQSTSVSVSCDTT 866 WR + +TSV+V C TT Sbjct: 167104 WRVMSATSVAVRCGTT 167151 Score = 24.6 bits (52), Expect = 4.6 Identities = 11/34 (32%), Positives = 17/34 (49%) Frame = -3 Query: 936 LPEDRDNIANNHTCAAIVCEVRQLRAGNRVQVEI 969 LP+ + + NH C C + L A N + V+I Sbjct: 17408 LPQGKRCVTGNHLC*RFECR*K*LNAHNHLDVKI 17307 Score = 24.6 bits (52), Expect = 4.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 837 KDSENKNYFLYLTGWRTIQSTSVSVSCDTT 866 K +++N Y++ W+T S ++C TT Sbjct: 19240 KKGKSRNLLQYISKWKTYCSQMSHLNCKTT 19151 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.317 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 321,778 Number of Sequences: 1 Number of extensions: 4343 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 23 length of query: 1086 length of database: 107,549 effective HSP length: 79 effective length of query: 1007 effective length of database: 107,470 effective search space: 108222290 effective search space used: 108222290 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|11279260|pir||JC7294 alphaP integrin - sea urchin (Strongylocentrotus purpuratus) (1054 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 60 1e-19 >super_15687 Length = 322648 Score = 60.5 bits (145), Expect(2) = 2e-19 Identities = 33/71 (46%), Positives = 47/71 (65%), Gaps = 4/71 (5%) Frame = -1 Query: 345 PQMLTGKKIR-ARFGFPITSIGDSNQDGFNDVAIGAPYD--GEDNSGVVYIYHGSAEGLR 401 PQ+L+G + ARFG + S GD +Q+G++DV IGAPY+ +SG +Y+Y+ S GL Sbjct: 111904 PQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 111725 Query: 402 LTESQV-LTPS 411 T QV L+PS Sbjct: 111724 ETNRQVSLSPS 111692 Score = 60.5 bits (145), Expect(2) = 1e-19 Identities = 33/71 (46%), Positives = 47/71 (65%), Gaps = 4/71 (5%) Frame = -1 Query: 345 PQMLTGKKIR-ARFGFPITSIGDSNQDGFNDVAIGAPYD--GEDNSGVVYIYHGSAEGLR 401 PQ+L+G + ARFG + S GD +Q+G++DV IGAPY+ +SG +Y+Y+ S GL Sbjct: 124054 PQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 123875 Query: 402 LTESQV-LTPS 411 T QV L+PS Sbjct: 123874 ETNRQVSLSPS 123842 Score = 49.3 bits (116), Expect(2) = 1e-19 Identities = 29/97 (29%), Positives = 52/97 (52%), Gaps = 5/97 (5%) Frame = -3 Query: 416 SDITTFGFS----VDGGQDMDQNDYPDLVVGAESADAAILVRTRPVVLLEAELTIEPIGI 471 S + FG+S V G D+D N YPD++VG+ +D+ ++R+RP++ ++A + ++P I Sbjct: 123788 SSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRFI 123609 Query: 472 NLDNKTYELPDGTMVTSFVAMAC-FTYTGNHLPARIG 507 ++ G+ S V + T+ H P IG Sbjct: 123608 DV----ITCVTGSAACSSVRICLNATFRKEHPPTNIG 123510 Score = 48.9 bits (115), Expect(2) = 2e-19 Identities = 29/97 (29%), Positives = 52/97 (52%), Gaps = 5/97 (5%) Frame = -3 Query: 416 SDITTFGFS----VDGGQDMDQNDYPDLVVGAESADAAILVRTRPVVLLEAELTIEPIGI 471 S + FG+S V G D+D N YPD++VG+ +D+ ++R+RP++ ++A + ++P I Sbjct: 111638 SSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRLI 111459 Query: 472 NLDNKTYELPDGTMVTSFVAMAC-FTYTGNHLPARIG 507 ++ G+ S V + T+ H P IG Sbjct: 111458 DV----ITCVTGSAACSSVRICLNATFRKEHPPTNIG 111360 Score = 32.7 bits (73), Expect = 0.016 Identities = 17/40 (42%), Positives = 24/40 (59%) Frame = -1 Query: 404 ESQVLTPSELGFSDITTFGFSVDGGQDMDQNDYPDLVVGA 443 + QVL+ S L + FG SV D+DQN Y D+++GA Sbjct: 111907 QPQVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGA 111797 Score = 32.7 bits (73), Expect = 0.016 Identities = 17/40 (42%), Positives = 24/40 (59%) Frame = -1 Query: 404 ESQVLTPSELGFSDITTFGFSVDGGQDMDQNDYPDLVVGA 443 + QVL+ S L + FG SV D+DQN Y D+++GA Sbjct: 124057 QPQVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGA 123947 Score = 25.0 bits (53), Expect = 3.4 Identities = 19/67 (28%), Positives = 31/67 (45%), Gaps = 15/67 (22%) Frame = -3 Query: 239 GYSLALG-----DFNGDGLEDYVVGTPRGESL-----RGLVAI-----FDQSLVEIITPV 283 GYSL G D + + D +VG+PR +S+ R ++ + L+++IT V Sbjct: 111620 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRLIDVITCV 111441 Query: 284 VGEQIVS 290 G S Sbjct: 111440 TGSAACS 111420 Score = 24.6 bits (52), Expect = 4.5 Identities = 15/53 (28%), Positives = 24/53 (44%) Frame = -3 Query: 239 GYSLALGDFNGDGLEDYVVGTPRGESLRGLVAIFDQSLVEIITPVVGEQIVSY 291 GYS+ G+F G E G P+ +S + V + +VG ++SY Sbjct: 112748 GYSVTSGNFYGGATEYIASGVPKFQS---------KGTVIVRGAIVGTLLISY 112617 Score = 24.6 bits (52), Expect = 4.5 Identities = 15/53 (28%), Positives = 24/53 (44%) Frame = -1 Query: 239 GYSLALGDFNGDGLEDYVVGTPRGESLRGLVAIFDQSLVEIITPVVGEQIVSY 291 GYS+ G+F G E G P+ +S + V + +VG ++SY Sbjct: 124894 GYSVTSGNFYGGATEYIASGVPKFQS---------KGTVIVRGAIVGTLLISY 124763 Score = 24.3 bits (51), Expect = 5.8 Identities = 18/49 (36%), Positives = 25/49 (50%), Gaps = 8/49 (16%) Frame = -3 Query: 239 GYSLALG-----DFNGDGLEDYVVGTPRGES---LRGLVAIFDQSLVEI 279 GYSL G D + + D +VG+PR +S LR I Q+ VE+ Sbjct: 123770 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVEL 123624 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.315 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 321,564 Number of Sequences: 1 Number of extensions: 4268 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 26 length of query: 1054 length of database: 107,549 effective HSP length: 79 effective length of query: 975 effective length of database: 107,470 effective search space: 104783250 effective search space used: 104783250 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|7512074|pir||T31437 integrin alpha chain SU2 - sea urchin (Lytechinus variegatus) (1041 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 62 3e-11 >super_15687 Length = 322648 Score = 61.6 bits (148), Expect = 3e-11 Identities = 34/71 (47%), Positives = 48/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 349 LSSTLIGGQIRSRFGLSIASIGDSNQDGFNDVAIGAPYE---GDDAGAVYIYHGSANGLK 405 LS + + G +RFG+S+AS GD +Q+G++DV IGAPYE +GA+Y+Y+ S GL Sbjct: 124045 LSGSSLSG---ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 123875 Query: 406 STPAQV-LTPS 415 T QV L+PS Sbjct: 123874 ETNRQVSLSPS 123842 Score = 61.6 bits (148), Expect = 3e-11 Identities = 34/71 (47%), Positives = 48/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 349 LSSTLIGGQIRSRFGLSIASIGDSNQDGFNDVAIGAPYE---GDDAGAVYIYHGSANGLK 405 LS + + G +RFG+S+AS GD +Q+G++DV IGAPYE +GA+Y+Y+ S GL Sbjct: 111895 LSGSSLSG---ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 111725 Query: 406 STPAQV-LTPS 415 T QV L+PS Sbjct: 111724 ETNRQVSLSPS 111692 Score = 53.9 bits (128), Expect(2) = 4e-10 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = -2 Query: 289 AYFGYSVTVVDINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRLS 348 AYFG++V +DIN D+YDDLLV AP+Y D + ++ G V++++ N PG +S Sbjct: 112521 AYFGHTVVAMDINKDSYDDLLVSAPLYND----VNGYDQGKVFLFMNN-QTHPGHQMWVS 112357 Query: 349 LSSTL 353 STL Sbjct: 112356 HPSTL 112342 Score = 53.9 bits (128), Expect(2) = 4e-10 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = -3 Query: 289 AYFGYSVTVVDINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRLS 348 AYFG++V +DIN D+YDDLLV AP+Y D + ++ G V++++ N PG +S Sbjct: 124667 AYFGHTVVAMDINKDSYDDLLVSAPLYND----VNGYDQGKVFLFMNN-QTHPGHQMWVS 124503 Query: 349 LSSTL 353 STL Sbjct: 124502 HPSTL 124488 Score = 46.6 bits (109), Expect = 1e-06 Identities = 24/73 (32%), Positives = 45/73 (60%), Gaps = 5/73 (6%) Frame = -3 Query: 405 KSTP-AQVLTPSTLGHSGITTFGFSL----QGGQDMDKNKYPDLLVGAESANTAVLIRTR 459 ++TP +Q + TL S + FG+SL G D+D N YPD++VG+ +++ ++R+R Sbjct: 123833 RNTPLSQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSR 123657 Query: 460 PVVSLDATLNTEP 472 P++ + A + +P Sbjct: 123656 PIIDVQARVELQP 123618 Score = 46.6 bits (109), Expect = 1e-06 Identities = 24/73 (32%), Positives = 45/73 (60%), Gaps = 5/73 (6%) Frame = -3 Query: 405 KSTP-AQVLTPSTLGHSGITTFGFSL----QGGQDMDKNKYPDLLVGAESANTAVLIRTR 459 ++TP +Q + TL S + FG+SL G D+D N YPD++VG+ +++ ++R+R Sbjct: 111683 RNTPLSQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSR 111507 Query: 460 PVVSLDATLNTEP 472 P++ + A + +P Sbjct: 111506 PIIDVQARVELQP 111468 Score = 31.2 bits (69), Expect = 0.047 Identities = 20/63 (31%), Positives = 33/63 (51%), Gaps = 1/63 (1%) Frame = -1 Query: 289 AYFGYSVTVV-DINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRL 347 A FG SV D++ + YDD+++GAP + +GA+YVY + + ++ Sbjct: 111871 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS-----SGAIYVYYNSHGGLTETNRQV 111707 Query: 348 SLS 350 SLS Sbjct: 111706 SLS 111698 Score = 31.2 bits (69), Expect = 0.047 Identities = 20/63 (31%), Positives = 33/63 (51%), Gaps = 1/63 (1%) Frame = -1 Query: 289 AYFGYSVTVV-DINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRL 347 A FG SV D++ + YDD+++GAP + +GA+YVY + + ++ Sbjct: 124021 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS-----SGAIYVYYNSHGGLTETNRQV 123857 Query: 348 SLS 350 SLS Sbjct: 123856 SLS 123848 Score = 30.8 bits (68), Expect = 0.061 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -1 Query: 410 QVLTPSTLGHSGITTFGFSLQGGQDMDKNKYPDLLVGA---ESANTA 453 QVL+ S+L + FG S+ D+D+N Y D+++GA ES +T+ Sbjct: 111901 QVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS 111770 Score = 30.8 bits (68), Expect = 0.061 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -1 Query: 410 QVLTPSTLGHSGITTFGFSLQGGQDMDKNKYPDLLVGA---ESANTA 453 QVL+ S+L + FG S+ D+D+N Y D+++GA ES +T+ Sbjct: 124051 QVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS 123920 Score = 28.5 bits (62), Expect = 0.30 Identities = 13/31 (41%), Positives = 20/31 (63%), Gaps = 5/31 (16%) Frame = -3 Query: 288 VAYFGYSVT-----VVDINNDTYDDLLVGAP 313 V FGYS+ VD++N+ Y D++VG+P Sbjct: 111632 VLQFGYSLVNGVAGAVDVDNNHYPDVIVGSP 111540 Score = 28.5 bits (62), Expect = 0.30 Identities = 13/31 (41%), Positives = 20/31 (63%), Gaps = 5/31 (16%) Frame = -3 Query: 288 VAYFGYSVT-----VVDINNDTYDDLLVGAP 313 V FGYS+ VD++N+ Y D++VG+P Sbjct: 123782 VLQFGYSLVNGVAGAVDVDNNHYPDVIVGSP 123690 Score = 25.0 bits (53), Expect = 3.4 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = -2 Query: 54 ALVGAPEASTNQSGVTKGGAVYSVCRPLSGPSVCEQIPF 92 +++ +P + + + V G ++CR PS+ +Q PF Sbjct: 312312 SILPSPGVNNSLAVVVTGSMFLTLCRVSMDPSILKQCPF 312196 Score = 25.0 bits (53), Expect = 3.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 134 ASVTMRQEREPTGTCFVGDSDFTNFVNY 161 A T++ P CF GD+ +FVNY Sbjct: 26150 AKPTVQINTYPFTCCFAGDAKENHFVNY 26233 Score = 24.6 bits (52), Expect = 4.4 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +2 Query: 894 CASDSCVLINCTIDEINASKSKVVRILGRFWERTFQKAVSELTP 937 C SCV++ CT IN K V+ L T + + P Sbjct: 314615 CYLVSCVVVQCTTPWINVLKKTVLSTLSALTAVTVNQLSTSFGP 314746 Score = 24.3 bits (51), Expect = 5.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = -3 Query: 239 GYSLALG-----DFNGDGVQDYVVGTPRAESLMGL 268 GYSL G D + + D +VG+PR++S+ L Sbjct: 123770 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVL 123666 Score = 24.3 bits (51), Expect = 5.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = -3 Query: 239 GYSLALG-----DFNGDGVQDYVVGTPRAESLMGL 268 GYSL G D + + D +VG+PR++S+ L Sbjct: 111620 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVL 111516 Score = 23.9 bits (50), Expect = 7.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 686 SDLRIITCDTGNPMVGKNILEFGLTL 711 SDL +T T NP K I+E G+TL Sbjct: 91188 SDLT*VT--TTNPFTNKEIIEQGMTL 91117 Score = 23.5 bits (49), Expect(2) = 4e-10 Identities = 14/52 (26%), Positives = 25/52 (47%) Frame = -3 Query: 239 GYSLALGDFNGDGVQDYVVGTPRAESLMGLVAIFDQNLNQFNQVMGTQIVAY 290 GYS+ G+F G + G P+ +S G V + ++GT +++Y Sbjct: 112748 GYSVTSGNFYGGATEYIASGVPKFQS-KGTVIV-------RGAIVGTLLISY 112617 Score = 23.5 bits (49), Expect(2) = 4e-10 Identities = 14/52 (26%), Positives = 25/52 (47%) Frame = -1 Query: 239 GYSLALGDFNGDGVQDYVVGTPRAESLMGLVAIFDQNLNQFNQVMGTQIVAY 290 GYS+ G+F G + G P+ +S G V + ++GT +++Y Sbjct: 124894 GYSVTSGNFYGGATEYIASGVPKFQS-KGTVIV-------RGAIVGTLLISY 124763 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.315 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 321,948 Number of Sequences: 1 Number of extensions: 4383 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 40 length of query: 1041 length of database: 107,549 effective HSP length: 79 effective length of query: 962 effective length of database: 107,470 effective search space: 103386140 effective search space used: 103386140 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|1763553|gb|AAB39741.1| integrin beta G subunit [Strongylocentrotus purpuratus] (90 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 25 0.16 >super_15687 Length = 322648 Score = 24.6 bits (52), Expect = 0.16 Identities = 10/28 (35%), Positives = 15/28 (52%) Frame = +1 Query: 39 MPYVSTVPEKLIAPCTGCEAPYGFKNVL 66 +P + VPE +I C+G + F N L Sbjct: 125788 LPSIEGVPESVITFCSGANIVFKFANPL 125871 Score = 23.9 bits (50), Expect = 0.27 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 40 PYVSTVPEKLIAPCTGCEAPYGFKNVL 66 P + VPE +I C+G + F N L Sbjct: 113652 PSIEGVPESVITFCSGANIVFKFANPL 113732 Score = 20.4 bits (41), Expect = 3.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 30 FGSFVDKTVMP 40 F FVDKT++P Sbjct: 145638 FKGFVDKTIVP 145670 Score = 20.0 bits (40), Expect = 3.9 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 Query: 56 CEAPYGFKNV 65 C PYGFK + Sbjct: 234599 CRLPYGFKTL 234628 Score = 20.0 bits (40), Expect = 3.9 Identities = 9/21 (42%), Positives = 14/21 (65%) Frame = +1 Query: 63 KNVLPLNENTNLFSETVMNQR 83 +N+L L +LFS +MNQ+ Sbjct: 316072 QNILLLYN*LDLFSTKLMNQK 316134 Score = 19.6 bits (39), Expect = 5.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 64 NVLPLNENTNLF 75 +VLP N+N +LF Sbjct: 184412 HVLPANQNLSLF 184447 Score = 19.2 bits (38), Expect = 6.7 Identities = 7/16 (43%), Positives = 8/16 (49%) Frame = +1 Query: 41 YVSTVPEKLIAPCTGC 56 Y +T PCTGC Sbjct: 151225 YPTTTNTNNNTPCTGC 151272 Score = 18.9 bits (37), Expect = 8.8 Identities = 9/21 (42%), Positives = 12/21 (56%) Frame = +3 Query: 36 KTVMPYVSTVPEKLIAPCTGC 56 K V+ ST+PE+ A GC Sbjct: 297765 KEVLHPGSTMPEQTSAMSKGC 297827 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.316 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,410 Number of Sequences: 1 Number of extensions: 304 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 90 length of database: 107,549 effective HSP length: 55 effective length of query: 35 effective length of database: 107,494 effective search space: 3762290 effective search space used: 3762290 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 37 (19.8 bits) S2: 37 (18.9 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|3386528|gb|AAC28382.1| integrin beta L subunit [Strongylocentrotus purpuratus] (802 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 27 0.67 >super_15687 Length = 322648 Score = 26.9 bits (58), Expect = 0.67 Identities = 17/45 (37%), Positives = 20/45 (43%), Gaps = 6/45 (13%) Frame = -3 Query: 581 CQCNPGFEGDSCDCPTRFDMCAAS------NGLECNAHGTCVCGC 619 C C PGF + T D CAAS + L N G+ CGC Sbjct: 175223 CLCPPGFILTNHTVCTDIDECAASAADHGCSQLCVNNPGSYTCGC 175089 Score = 24.6 bits (52), Expect = 3.3 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -1 Query: 580 KCQCNPGFEGDSCDCPTRFDMCAASNG---LEC-NAHGTCVCGCLRVFADSQFQGKTC 633 +C C+ G++ + + D CA +NG +C N G+ C C F KTC Sbjct: 172408 RCGCDAGYQFNGTHGCSDIDECAFANGNCSQQCVNQPGSYHCECQANF-KLDTDNKTC 172238 Score = 24.3 bits (51), Expect = 4.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 Query: 682 YTEDNPKCNFPLSDDCTFQFVVVSENETVTVYV 714 +T N+P S DCT+ S N+ + +V Sbjct: 178960 FTSPGYPSNYPQSSDCTYNIQPSSGNQILLSFV 178862 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.319 0.136 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 342,718 Number of Sequences: 1 Number of extensions: 6471 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 27 length of query: 802 length of database: 107,549 effective HSP length: 77 effective length of query: 725 effective length of database: 107,472 effective search space: 77917200 effective search space used: 77917200 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|1763547|gb|AAB39739.1| integrin beta G subunit [Strongylocentrotus purpuratus] (783 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 28 0.22 >super_15687 Length = 322648 Score = 28.5 bits (62), Expect = 0.22 Identities = 19/84 (22%), Positives = 37/84 (43%) Frame = -1 Query: 547 DRYLGELCGGSDRGQCVCDEYTRRSQCRCRSGYTGDACECSTRVDTCMTGDTICNGEGVC 606 + +L +L G +G C ++ +C C +GY + + +D C + C+ + V Sbjct: 172474 NEFLNKLRAGRRQG---CYSHSINFRCGCDAGYQFNGTHGCSDIDECAFANGNCSQQCVN 172304 Query: 607 ICGECKCNAGSSYRGALCQDCPTC 630 G C ++++ L D TC Sbjct: 172303 QPGSYHCECQANFK--LDTDNKTC 172238 Score = 25.4 bits (54), Expect = 1.9 Identities = 10/19 (52%), Positives = 12/19 (62%) Frame = +3 Query: 467 NGTLECGSCICNPGHYGRY 485 NG L+C +CI N G Y Y Sbjct: 8085 NGKLKCMTCILNQGSYVLY 8141 Score = 24.6 bits (52), Expect = 3.2 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 36 CGECISLDSSCGW--CTLLNYTDDTG 59 C ECIS D W CT L++ D G Sbjct: 192611 CIECISTDHCQNWLTCTTLHWWGDGG 192534 Score = 24.6 bits (52), Expect = 3.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 473 GSCICNPGHYGRYCECS 489 GS C HY R C CS Sbjct: 160602 GSARCATNHYSRGCSCS 160552 Score = 24.6 bits (52), Expect = 3.2 Identities = 10/28 (35%), Positives = 15/28 (52%) Frame = +1 Query: 184 MPYVSTVPEKLIAPCTGCEAPYGFKNVL 211 +P + VPE +I C+G + F N L Sbjct: 125788 LPSIEGVPESVITFCSGANIVFKFANPL 125871 Score = 24.6 bits (52), Expect = 3.2 Identities = 10/36 (27%), Positives = 12/36 (32%) Frame = -3 Query: 565 DEYTRRSQCRCRSGYTGDACECSTRVDTCMTGDTIC 600 + Y +C S C C D C GD C Sbjct: 219032 NNYPSGPSVQCNSDQPNSVCSCCCSDDGCNRGDLDC 218925 Score = 24.3 bits (51), Expect = 4.2 Identities = 9/21 (42%), Positives = 12/21 (56%) Frame = +2 Query: 604 GVCICGECKCNAGSSYRGALC 624 GVC+ G KC +RG+ C Sbjct: 19988 GVCMAGV*KCQGKLLFRGSYC 20050 Score = 23.9 bits (50), Expect = 5.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 185 PYVSTVPEKLIAPCTGCEAPYGFKNVL 211 P + VPE +I C+G + F N L Sbjct: 113652 PSIEGVPESVITFCSGANIVFKFANPL 113732 Score = 23.1 bits (48), Expect = 9.4 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 13/63 (20%) Frame = -3 Query: 475 CICNPGHY--GRYCECSSDD--PTLEDNDAPCDITKHIHRCS-GRGSC--VCGN------ 521 CIC PG+Y G CS + LE ++ C+ G SC +C N Sbjct: 174893 CICRPGYYLLGNGYNCSGNYLLSMLEKKPTKYTNISDVNECNEGLHSCDQICVNEIGYHR 174714 Query: 522 CIC 524 C+C Sbjct: 174713 CLC 174705 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.319 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 343,368 Number of Sequences: 1 Number of extensions: 6711 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of query: 783 length of database: 107,549 effective HSP length: 76 effective length of query: 707 effective length of database: 107,473 effective search space: 75983411 effective search space used: 75983411 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|7934567|gb|AAB39740.2| integrin beta-C subunit [Strongylocentrotus purpuratus] (806 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 25 2.0 >super_15687 Length = 322648 Score = 25.4 bits (54), Expect = 2.0 Identities = 12/32 (37%), Positives = 16/32 (49%), Gaps = 1/32 (3%) Frame = -2 Query: 537 GTCVCGECECDTRGDPNRIIT-GEYCQCDNYL 567 GTCV C++ G+P + C CDN L Sbjct: 14136 GTCVSYTTHCNSSGNPTMGAR*SDDCPCDNLL 14041 Score = 24.6 bits (52), Expect = 3.3 Identities = 12/31 (38%), Positives = 15/31 (47%), Gaps = 1/31 (3%) Frame = +2 Query: 594 CGCLEGYQGSACECPTSNDTCRAP-NGEICN 623 CGC G + CP+S TC P + CN Sbjct: 98192 CGC--GVTSISAACPSSTATCTKPLSRSTCN 98278 Score = 23.9 bits (50), Expect = 5.7 Identities = 15/53 (28%), Positives = 19/53 (35%) Frame = -1 Query: 594 CGCLEGYQGSACECPTSNDTCRAPNGEICNGVRTCDCGKCQCNDPKYSGATCQ 646 CGC GYQ + + D C NG +C + N P CQ Sbjct: 172405 CGCDAGYQFNGTHGCSDIDECAFANG---------NCSQQCVNQPGSYHCECQ 172274 Score = 23.5 bits (49), Expect = 7.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 561 CQCDNYLCPRSGGEVC 576 C C +YLC R+G C Sbjct: 259493 CPCRDYLCSRAGYPNC 259540 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.320 0.137 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 361,028 Number of Sequences: 1 Number of extensions: 7262 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 20 length of query: 806 length of database: 107,549 effective HSP length: 77 effective length of query: 729 effective length of database: 107,472 effective search space: 78347088 effective search space used: 78347088 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|5911266|gb|AAD55725.1|AF177915_1 calreticulin precursor [Strongylocentrotus purpuratus] (421 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 22 7.9 >super_15687 Length = 322648 Score = 22.3 bits (46), Expect = 7.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 59 AEQDKGIQTSQDAKFYGLSAKFTDFSNEGKDLVIQFTVKHEQKIDC 104 A DK + +A ++A+ NE + I F VKH QKI C Sbjct: 236638 ASPDKNQPSQSNAAHCDITAQI---GNEPYN-AIAFDVKHRQKIIC 236763 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.314 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 118,730 Number of Sequences: 1 Number of extensions: 1665 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 421 length of database: 107,549 effective HSP length: 71 effective length of query: 350 effective length of database: 107,478 effective search space: 37617300 effective search space used: 37617300 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|5911264|gb|AAD55724.1|AF177914_1 alphaP integrin precursor [Strongylocentrotus purpuratus] (1054 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 60 1e-19 >super_15687 Length = 322648 Score = 60.5 bits (145), Expect(2) = 2e-19 Identities = 33/71 (46%), Positives = 47/71 (65%), Gaps = 4/71 (5%) Frame = -1 Query: 345 PQMLTGKKIR-ARFGFPITSIGDSNQDGFNDVAIGAPYD--GEDNSGVVYIYHGSAEGLR 401 PQ+L+G + ARFG + S GD +Q+G++DV IGAPY+ +SG +Y+Y+ S GL Sbjct: 111904 PQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 111725 Query: 402 LTESQV-LTPS 411 T QV L+PS Sbjct: 111724 ETNRQVSLSPS 111692 Score = 60.5 bits (145), Expect(2) = 1e-19 Identities = 33/71 (46%), Positives = 47/71 (65%), Gaps = 4/71 (5%) Frame = -1 Query: 345 PQMLTGKKIR-ARFGFPITSIGDSNQDGFNDVAIGAPYD--GEDNSGVVYIYHGSAEGLR 401 PQ+L+G + ARFG + S GD +Q+G++DV IGAPY+ +SG +Y+Y+ S GL Sbjct: 124054 PQVLSGSSLSGARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 123875 Query: 402 LTESQV-LTPS 411 T QV L+PS Sbjct: 123874 ETNRQVSLSPS 123842 Score = 49.3 bits (116), Expect(2) = 1e-19 Identities = 29/97 (29%), Positives = 52/97 (52%), Gaps = 5/97 (5%) Frame = -3 Query: 416 SDITTFGFS----VDGGQDMDQNDYPDLVVGAESADAAILVRTRPVVLLEAELTIEPIGI 471 S + FG+S V G D+D N YPD++VG+ +D+ ++R+RP++ ++A + ++P I Sbjct: 123788 SSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRFI 123609 Query: 472 NLDNKTYELPDGTMVTSFVAMAC-FTYTGNHLPARIG 507 ++ G+ S V + T+ H P IG Sbjct: 123608 DV----ITCVTGSAACSSVRICLNATFRKEHPPTNIG 123510 Score = 48.9 bits (115), Expect(2) = 2e-19 Identities = 29/97 (29%), Positives = 52/97 (52%), Gaps = 5/97 (5%) Frame = -3 Query: 416 SDITTFGFS----VDGGQDMDQNDYPDLVVGAESADAAILVRTRPVVLLEAELTIEPIGI 471 S + FG+S V G D+D N YPD++VG+ +D+ ++R+RP++ ++A + ++P I Sbjct: 111638 SSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRLI 111459 Query: 472 NLDNKTYELPDGTMVTSFVAMAC-FTYTGNHLPARIG 507 ++ G+ S V + T+ H P IG Sbjct: 111458 DV----ITCVTGSAACSSVRICLNATFRKEHPPTNIG 111360 Score = 32.7 bits (73), Expect = 0.016 Identities = 17/40 (42%), Positives = 24/40 (59%) Frame = -1 Query: 404 ESQVLTPSELGFSDITTFGFSVDGGQDMDQNDYPDLVVGA 443 + QVL+ S L + FG SV D+DQN Y D+++GA Sbjct: 111907 QPQVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGA 111797 Score = 32.7 bits (73), Expect = 0.016 Identities = 17/40 (42%), Positives = 24/40 (59%) Frame = -1 Query: 404 ESQVLTPSELGFSDITTFGFSVDGGQDMDQNDYPDLVVGA 443 + QVL+ S L + FG SV D+DQN Y D+++GA Sbjct: 124057 QPQVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGA 123947 Score = 25.0 bits (53), Expect = 3.4 Identities = 19/67 (28%), Positives = 31/67 (45%), Gaps = 15/67 (22%) Frame = -3 Query: 239 GYSLALG-----DFNGDGLEDYVVGTPRGESL-----RGLVAI-----FDQSLVEIITPV 283 GYSL G D + + D +VG+PR +S+ R ++ + L+++IT V Sbjct: 111620 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVELQPRLIDVITCV 111441 Query: 284 VGEQIVS 290 G S Sbjct: 111440 TGSAACS 111420 Score = 24.6 bits (52), Expect = 4.5 Identities = 15/53 (28%), Positives = 24/53 (44%) Frame = -3 Query: 239 GYSLALGDFNGDGLEDYVVGTPRGESLRGLVAIFDQSLVEIITPVVGEQIVSY 291 GYS+ G+F G E G P+ +S + V + +VG ++SY Sbjct: 112748 GYSVTSGNFYGGATEYIASGVPKFQS---------KGTVIVRGAIVGTLLISY 112617 Score = 24.6 bits (52), Expect = 4.5 Identities = 15/53 (28%), Positives = 24/53 (44%) Frame = -1 Query: 239 GYSLALGDFNGDGLEDYVVGTPRGESLRGLVAIFDQSLVEIITPVVGEQIVSY 291 GYS+ G+F G E G P+ +S + V + +VG ++SY Sbjct: 124894 GYSVTSGNFYGGATEYIASGVPKFQS---------KGTVIVRGAIVGTLLISY 124763 Score = 24.3 bits (51), Expect = 5.8 Identities = 18/49 (36%), Positives = 25/49 (50%), Gaps = 8/49 (16%) Frame = -3 Query: 239 GYSLALG-----DFNGDGLEDYVVGTPRGES---LRGLVAIFDQSLVEI 279 GYSL G D + + D +VG+PR +S LR I Q+ VE+ Sbjct: 123770 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSRPIIDVQARVEL 123624 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.315 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 321,564 Number of Sequences: 1 Number of extensions: 4268 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 26 length of query: 1054 length of database: 107,549 effective HSP length: 79 effective length of query: 975 effective length of database: 107,470 effective search space: 104783250 effective search space used: 104783250 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|4558371|gb|AAD22567.1|U22152_1 alpha-Lv1 integrin [Lytechinus variegatus] (1041 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 62 3e-11 >super_15687 Length = 322648 Score = 61.6 bits (148), Expect = 3e-11 Identities = 34/71 (47%), Positives = 48/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 349 LSSTLIGGQIRSRFGLSIASIGDSNQDGFNDVAIGAPYE---GDDAGAVYIYHGSANGLK 405 LS + + G +RFG+S+AS GD +Q+G++DV IGAPYE +GA+Y+Y+ S GL Sbjct: 124045 LSGSSLSG---ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 123875 Query: 406 STPAQV-LTPS 415 T QV L+PS Sbjct: 123874 ETNRQVSLSPS 123842 Score = 61.6 bits (148), Expect = 3e-11 Identities = 34/71 (47%), Positives = 48/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 349 LSSTLIGGQIRSRFGLSIASIGDSNQDGFNDVAIGAPYE---GDDAGAVYIYHGSANGLK 405 LS + + G +RFG+S+AS GD +Q+G++DV IGAPYE +GA+Y+Y+ S GL Sbjct: 111895 LSGSSLSG---ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 111725 Query: 406 STPAQV-LTPS 415 T QV L+PS Sbjct: 111724 ETNRQVSLSPS 111692 Score = 53.9 bits (128), Expect(2) = 4e-10 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = -2 Query: 289 AYFGYSVTVVDINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRLS 348 AYFG++V +DIN D+YDDLLV AP+Y D + ++ G V++++ N PG +S Sbjct: 112521 AYFGHTVVAMDINKDSYDDLLVSAPLYND----VNGYDQGKVFLFMNN-QTHPGHQMWVS 112357 Query: 349 LSSTL 353 STL Sbjct: 112356 HPSTL 112342 Score = 53.9 bits (128), Expect(2) = 4e-10 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = -3 Query: 289 AYFGYSVTVVDINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRLS 348 AYFG++V +DIN D+YDDLLV AP+Y D + ++ G V++++ N PG +S Sbjct: 124667 AYFGHTVVAMDINKDSYDDLLVSAPLYND----VNGYDQGKVFLFMNN-QTHPGHQMWVS 124503 Query: 349 LSSTL 353 STL Sbjct: 124502 HPSTL 124488 Score = 46.6 bits (109), Expect = 1e-06 Identities = 24/73 (32%), Positives = 45/73 (60%), Gaps = 5/73 (6%) Frame = -3 Query: 405 KSTP-AQVLTPSTLGHSGITTFGFSL----QGGQDMDKNKYPDLLVGAESANTAVLIRTR 459 ++TP +Q + TL S + FG+SL G D+D N YPD++VG+ +++ ++R+R Sbjct: 123833 RNTPLSQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSR 123657 Query: 460 PVVSLDATLNTEP 472 P++ + A + +P Sbjct: 123656 PIIDVQARVELQP 123618 Score = 46.6 bits (109), Expect = 1e-06 Identities = 24/73 (32%), Positives = 45/73 (60%), Gaps = 5/73 (6%) Frame = -3 Query: 405 KSTP-AQVLTPSTLGHSGITTFGFSL----QGGQDMDKNKYPDLLVGAESANTAVLIRTR 459 ++TP +Q + TL S + FG+SL G D+D N YPD++VG+ +++ ++R+R Sbjct: 111683 RNTPLSQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSR 111507 Query: 460 PVVSLDATLNTEP 472 P++ + A + +P Sbjct: 111506 PIIDVQARVELQP 111468 Score = 31.2 bits (69), Expect = 0.047 Identities = 20/63 (31%), Positives = 33/63 (51%), Gaps = 1/63 (1%) Frame = -1 Query: 289 AYFGYSVTVV-DINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRL 347 A FG SV D++ + YDD+++GAP + +GA+YVY + + ++ Sbjct: 111871 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS-----SGAIYVYYNSHGGLTETNRQV 111707 Query: 348 SLS 350 SLS Sbjct: 111706 SLS 111698 Score = 31.2 bits (69), Expect = 0.047 Identities = 20/63 (31%), Positives = 33/63 (51%), Gaps = 1/63 (1%) Frame = -1 Query: 289 AYFGYSVTVV-DINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRL 347 A FG SV D++ + YDD+++GAP + +GA+YVY + + ++ Sbjct: 124021 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS-----SGAIYVYYNSHGGLTETNRQV 123857 Query: 348 SLS 350 SLS Sbjct: 123856 SLS 123848 Score = 30.8 bits (68), Expect = 0.061 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -1 Query: 410 QVLTPSTLGHSGITTFGFSLQGGQDMDKNKYPDLLVGA---ESANTA 453 QVL+ S+L + FG S+ D+D+N Y D+++GA ES +T+ Sbjct: 111901 QVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS 111770 Score = 30.8 bits (68), Expect = 0.061 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -1 Query: 410 QVLTPSTLGHSGITTFGFSLQGGQDMDKNKYPDLLVGA---ESANTA 453 QVL+ S+L + FG S+ D+D+N Y D+++GA ES +T+ Sbjct: 124051 QVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS 123920 Score = 28.5 bits (62), Expect = 0.30 Identities = 13/31 (41%), Positives = 20/31 (63%), Gaps = 5/31 (16%) Frame = -3 Query: 288 VAYFGYSVT-----VVDINNDTYDDLLVGAP 313 V FGYS+ VD++N+ Y D++VG+P Sbjct: 111632 VLQFGYSLVNGVAGAVDVDNNHYPDVIVGSP 111540 Score = 28.5 bits (62), Expect = 0.30 Identities = 13/31 (41%), Positives = 20/31 (63%), Gaps = 5/31 (16%) Frame = -3 Query: 288 VAYFGYSVT-----VVDINNDTYDDLLVGAP 313 V FGYS+ VD++N+ Y D++VG+P Sbjct: 123782 VLQFGYSLVNGVAGAVDVDNNHYPDVIVGSP 123690 Score = 25.0 bits (53), Expect = 3.4 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = -2 Query: 54 ALVGAPEASTNQSGVTKGGAVYSVCRPLSGPSVCEQIPF 92 +++ +P + + + V G ++CR PS+ +Q PF Sbjct: 312312 SILPSPGVNNSLAVVVTGSMFLTLCRVSMDPSILKQCPF 312196 Score = 25.0 bits (53), Expect = 3.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 134 ASVTMRQEREPTGTCFVGDSDFTNFVNY 161 A T++ P CF GD+ +FVNY Sbjct: 26150 AKPTVQINTYPFTCCFAGDAKENHFVNY 26233 Score = 24.6 bits (52), Expect = 4.4 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +2 Query: 894 CASDSCVLINCTIDEINASKSKVVRILGRFWERTFQKAVSELTP 937 C SCV++ CT IN K V+ L T + + P Sbjct: 314615 CYLVSCVVVQCTTPWINVLKKTVLSTLSALTAVTVNQLSTSFGP 314746 Score = 24.3 bits (51), Expect = 5.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = -3 Query: 239 GYSLALG-----DFNGDGVQDYVVGTPRAESLMGL 268 GYSL G D + + D +VG+PR++S+ L Sbjct: 123770 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVL 123666 Score = 24.3 bits (51), Expect = 5.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = -3 Query: 239 GYSLALG-----DFNGDGVQDYVVGTPRAESLMGL 268 GYSL G D + + D +VG+PR++S+ L Sbjct: 111620 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVL 111516 Score = 23.9 bits (50), Expect = 7.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 686 SDLRIITCDTGNPMVGKNILEFGLTL 711 SDL +T T NP K I+E G+TL Sbjct: 91188 SDLT*VT--TTNPFTNKEIIEQGMTL 91117 Score = 23.5 bits (49), Expect(2) = 4e-10 Identities = 14/52 (26%), Positives = 25/52 (47%) Frame = -3 Query: 239 GYSLALGDFNGDGVQDYVVGTPRAESLMGLVAIFDQNLNQFNQVMGTQIVAY 290 GYS+ G+F G + G P+ +S G V + ++GT +++Y Sbjct: 112748 GYSVTSGNFYGGATEYIASGVPKFQS-KGTVIV-------RGAIVGTLLISY 112617 Score = 23.5 bits (49), Expect(2) = 4e-10 Identities = 14/52 (26%), Positives = 25/52 (47%) Frame = -1 Query: 239 GYSLALGDFNGDGVQDYVVGTPRAESLMGLVAIFDQNLNQFNQVMGTQIVAY 290 GYS+ G+F G + G P+ +S G V + ++GT +++Y Sbjct: 124894 GYSVTSGNFYGGATEYIASGVPKFQS-KGTVIV-------RGAIVGTLLISY 124763 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.315 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 319,578 Number of Sequences: 1 Number of extensions: 4321 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 33 length of query: 1041 length of database: 107,549 effective HSP length: 79 effective length of query: 962 effective length of database: 107,470 effective search space: 103386140 effective search space used: 103386140 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|3220241|gb|AAC23572.1| alpha integrin subunit SU2 [Lytechinus variegatus] (1041 letters) Database: cons/super_15687 1 sequences; 322,648 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value super_15687 62 3e-11 >super_15687 Length = 322648 Score = 61.6 bits (148), Expect = 3e-11 Identities = 34/71 (47%), Positives = 48/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 349 LSSTLIGGQIRSRFGLSIASIGDSNQDGFNDVAIGAPYE---GDDAGAVYIYHGSANGLK 405 LS + + G +RFG+S+AS GD +Q+G++DV IGAPYE +GA+Y+Y+ S GL Sbjct: 124045 LSGSSLSG---ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 123875 Query: 406 STPAQV-LTPS 415 T QV L+PS Sbjct: 123874 ETNRQVSLSPS 123842 Score = 61.6 bits (148), Expect = 3e-11 Identities = 34/71 (47%), Positives = 48/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 349 LSSTLIGGQIRSRFGLSIASIGDSNQDGFNDVAIGAPYE---GDDAGAVYIYHGSANGLK 405 LS + + G +RFG+S+AS GD +Q+G++DV IGAPYE +GA+Y+Y+ S GL Sbjct: 111895 LSGSSLSG---ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTSSGAIYVYYNSHGGLT 111725 Query: 406 STPAQV-LTPS 415 T QV L+PS Sbjct: 111724 ETNRQVSLSPS 111692 Score = 53.9 bits (128), Expect(2) = 4e-10 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = -2 Query: 289 AYFGYSVTVVDINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRLS 348 AYFG++V +DIN D+YDDLLV AP+Y D + ++ G V++++ N PG +S Sbjct: 112521 AYFGHTVVAMDINKDSYDDLLVSAPLYND----VNGYDQGKVFLFMNN-QTHPGHQMWVS 112357 Query: 349 LSSTL 353 STL Sbjct: 112356 HPSTL 112342 Score = 53.9 bits (128), Expect(2) = 4e-10 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = -3 Query: 289 AYFGYSVTVVDINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRLS 348 AYFG++V +DIN D+YDDLLV AP+Y D + ++ G V++++ N PG +S Sbjct: 124667 AYFGHTVVAMDINKDSYDDLLVSAPLYND----VNGYDQGKVFLFMNN-QTHPGHQMWVS 124503 Query: 349 LSSTL 353 STL Sbjct: 124502 HPSTL 124488 Score = 46.6 bits (109), Expect = 1e-06 Identities = 24/73 (32%), Positives = 45/73 (60%), Gaps = 5/73 (6%) Frame = -3 Query: 405 KSTP-AQVLTPSTLGHSGITTFGFSL----QGGQDMDKNKYPDLLVGAESANTAVLIRTR 459 ++TP +Q + TL S + FG+SL G D+D N YPD++VG+ +++ ++R+R Sbjct: 123833 RNTPLSQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSR 123657 Query: 460 PVVSLDATLNTEP 472 P++ + A + +P Sbjct: 123656 PIIDVQARVELQP 123618 Score = 46.6 bits (109), Expect = 1e-06 Identities = 24/73 (32%), Positives = 45/73 (60%), Gaps = 5/73 (6%) Frame = -3 Query: 405 KSTP-AQVLTPSTLGHSGITTFGFSL----QGGQDMDKNKYPDLLVGAESANTAVLIRTR 459 ++TP +Q + TL S + FG+SL G D+D N YPD++VG+ +++ ++R+R Sbjct: 111683 RNTPLSQRIIGKTL-KSSVLQFGYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVLRSR 111507 Query: 460 PVVSLDATLNTEP 472 P++ + A + +P Sbjct: 111506 PIIDVQARVELQP 111468 Score = 31.2 bits (69), Expect = 0.047 Identities = 20/63 (31%), Positives = 33/63 (51%), Gaps = 1/63 (1%) Frame = -1 Query: 289 AYFGYSVTVV-DINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRL 347 A FG SV D++ + YDD+++GAP + +GA+YVY + + ++ Sbjct: 111871 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS-----SGAIYVYYNSHGGLTETNRQV 111707 Query: 348 SLS 350 SLS Sbjct: 111706 SLS 111698 Score = 31.2 bits (69), Expect = 0.047 Identities = 20/63 (31%), Positives = 33/63 (51%), Gaps = 1/63 (1%) Frame = -1 Query: 289 AYFGYSVTVV-DINNDTYDDLLVGAPMYMDDGPAIQRWEAGAVYVYLQNPDVGPGASNRL 347 A FG SV D++ + YDD+++GAP + +GA+YVY + + ++ Sbjct: 124021 ARFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS-----SGAIYVYYNSHGGLTETNRQV 123857 Query: 348 SLS 350 SLS Sbjct: 123856 SLS 123848 Score = 30.8 bits (68), Expect = 0.061 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -1 Query: 410 QVLTPSTLGHSGITTFGFSLQGGQDMDKNKYPDLLVGA---ESANTA 453 QVL+ S+L + FG S+ D+D+N Y D+++GA ES +T+ Sbjct: 111901 QVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS 111770 Score = 30.8 bits (68), Expect = 0.061 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -1 Query: 410 QVLTPSTLGHSGITTFGFSLQGGQDMDKNKYPDLLVGA---ESANTA 453 QVL+ S+L + FG S+ D+D+N Y D+++GA ES +T+ Sbjct: 124051 QVLSGSSLSGA---RFGMSVASAGDLDQNGYDDVIIGAPYEESTSTS 123920 Score = 28.5 bits (62), Expect = 0.30 Identities = 13/31 (41%), Positives = 20/31 (63%), Gaps = 5/31 (16%) Frame = -3 Query: 288 VAYFGYSVT-----VVDINNDTYDDLLVGAP 313 V FGYS+ VD++N+ Y D++VG+P Sbjct: 111632 VLQFGYSLVNGVAGAVDVDNNHYPDVIVGSP 111540 Score = 28.5 bits (62), Expect = 0.30 Identities = 13/31 (41%), Positives = 20/31 (63%), Gaps = 5/31 (16%) Frame = -3 Query: 288 VAYFGYSVT-----VVDINNDTYDDLLVGAP 313 V FGYS+ VD++N+ Y D++VG+P Sbjct: 123782 VLQFGYSLVNGVAGAVDVDNNHYPDVIVGSP 123690 Score = 25.0 bits (53), Expect = 3.4 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = -2 Query: 54 ALVGAPEASTNQSGVTKGGAVYSVCRPLSGPSVCEQIPF 92 +++ +P + + + V G ++CR PS+ +Q PF Sbjct: 312312 SILPSPGVNNSLAVVVTGSMFLTLCRVSMDPSILKQCPF 312196 Score = 25.0 bits (53), Expect = 3.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 134 ASVTMRQEREPTGTCFVGDSDFTNFVNY 161 A T++ P CF GD+ +FVNY Sbjct: 26150 AKPTVQINTYPFTCCFAGDAKENHFVNY 26233 Score = 24.6 bits (52), Expect = 4.4 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +2 Query: 894 CASDSCVLINCTIDEINASKSKVVRILGRFWERTFQKAVSELTP 937 C SCV++ CT IN K V+ L T + + P Sbjct: 314615 CYLVSCVVVQCTTPWINVLKKTVLSTLSALTAVTVNQLSTSFGP 314746 Score = 24.3 bits (51), Expect = 5.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = -3 Query: 239 GYSLALG-----DFNGDGVQDYVVGTPRAESLMGL 268 GYSL G D + + D +VG+PR++S+ L Sbjct: 123770 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVL 123666 Score = 24.3 bits (51), Expect = 5.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = -3 Query: 239 GYSLALG-----DFNGDGVQDYVVGTPRAESLMGL 268 GYSL G D + + D +VG+PR++S+ L Sbjct: 111620 GYSLVNGVAGAVDVDNNHYPDVIVGSPRSDSVFVL 111516 Score = 23.9 bits (50), Expect = 7.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 686 SDLRIITCDTGNPMVGKNILEFGLTL 711 SDL +T T NP K I+E G+TL Sbjct: 91188 SDLT*VT--TTNPFTNKEIIEQGMTL 91117 Score = 23.5 bits (49), Expect(2) = 4e-10 Identities = 14/52 (26%), Positives = 25/52 (47%) Frame = -3 Query: 239 GYSLALGDFNGDGVQDYVVGTPRAESLMGLVAIFDQNLNQFNQVMGTQIVAY 290 GYS+ G+F G + G P+ +S G V + ++GT +++Y Sbjct: 112748 GYSVTSGNFYGGATEYIASGVPKFQS-KGTVIV-------RGAIVGTLLISY 112617 Score = 23.5 bits (49), Expect(2) = 4e-10 Identities = 14/52 (26%), Positives = 25/52 (47%) Frame = -1 Query: 239 GYSLALGDFNGDGVQDYVVGTPRAESLMGLVAIFDQNLNQFNQVMGTQIVAY 290 GYS+ G+F G + G P+ +S G V + ++GT +++Y Sbjct: 124894 GYSVTSGNFYGGATEYIASGVPKFQS-KGTVIV-------RGAIVGTLLISY 124763 Database: cons/super_15687 Posted date: Mar 4, 2004 2:53 PM Number of letters in database: 322,648 Number of sequences in database: 1 Lambda K H 0.315 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 321,948 Number of Sequences: 1 Number of extensions: 4383 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 40 length of query: 1041 length of database: 107,549 effective HSP length: 79 effective length of query: 962 effective length of database: 107,470 effective search space: 103386140 effective search space used: 103386140 frameshift window, decay const: 50, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits) TBLASTN 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alej